UniProt ID | RSAD2_MOUSE | |
---|---|---|
UniProt AC | Q8CBB9 | |
Protein Name | Radical S-adenosyl methionine domain-containing protein 2 | |
Gene Name | Rsad2 {ECO:0000312|MGI:MGI:1929628} | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 362 | |
Subcellular Localization |
Endoplasmic reticulum membrane Peripheral membrane protein Cytoplasmic side. Lipid droplet. |
|
Protein Description | Interferon-inducible iron-sulfur (4FE-4S) cluster-binding antiviral protein which plays a major role in the cell antiviral state induced by type I and type II interferon. Can inhibit a wide range of viruses, including west Nile virus (WNV), dengue virus, sindbis virus, influenza A virus, sendai virus and vesicular stomatitis virus (VSV). Displays antiviral activity against influenza A virus by inhibiting the budding of the virus from the plasma membrane by disturbing the lipid rafts. This is accomplished, at least in part, through binding and inhibition of the enzyme farnesyl diphosphate synthase (FPPS), which is essential for the biosynthesis of isoprenoid-derived lipids. Promotes TLR7 and TLR9-dependent production of IFN-beta production in plasmacytoid dendritic cells (pDCs) by facilitating Lys-63'-linked ubiquitination of IRAK1. Plays a role in CD4+ T-cells activation and differentiation. Facilitates T-cell receptor (TCR)-mediated GATA3 activation and optimal T-helper 2 (Th2) cytokine production by modulating NFKB1 and JUNB activities. Can inhibit secretion of soluble proteins.. | |
Protein Sequence | MGMLVPTALAARLLSLFQQQLGSLWSGLAILFCWLRIALGWLDPGKEQPQVRGEPEDTQETQEDGNSTQPTTPVSVNYHFTRQCNYKCGFCFHTAKTSFVLPLEEAKRGLLLLKQAGLEKINFSGGEPFLQDRGEYLGKLVRFCKEELALPSVSIVSNGSLIRERWFKDYGEYLDILAISCDSFDEQVNALIGRGQGKKNHVENLQKLRRWCRDYKVAFKINSVINRFNVDEDMNEHIKALSPVRWKVFQCLLIEGENSGEDALREAERFLISNEEFETFLERHKEVSCLVPESNQKMKDSYLILDEYMRFLNCTGGRKDPSKSILDVGVEEAIKFSGFDEKMFLKRGGKYVWSKADLKLDW | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
58 | Phosphorylation | VRGEPEDTQETQEDG CCCCCCCCCCCCCCC | 27.00 | 30635358 | |
61 | Phosphorylation | EPEDTQETQEDGNST CCCCCCCCCCCCCCC | 27.69 | 30635358 | |
67 | Phosphorylation | ETQEDGNSTQPTTPV CCCCCCCCCCCCCCE | 33.67 | 30635358 | |
68 | Phosphorylation | TQEDGNSTQPTTPVS CCCCCCCCCCCCCEE | 42.44 | 30635358 | |
71 | Phosphorylation | DGNSTQPTTPVSVNY CCCCCCCCCCEEEEE | 33.64 | 30635358 | |
72 | Phosphorylation | GNSTQPTTPVSVNYH CCCCCCCCCEEEEEE | 28.51 | 25159016 | |
75 | Phosphorylation | TQPTTPVSVNYHFTR CCCCCCEEEEEEEEC | 13.07 | 25159016 | |
78 | Phosphorylation | TTPVSVNYHFTRQCN CCCEEEEEEEECCCC | 8.99 | 30635358 | |
81 | Phosphorylation | VSVNYHFTRQCNYKC EEEEEEEECCCCCEE | 13.40 | 30635358 | |
198 | Acetylation | LIGRGQGKKNHVENL HHHCCCCCHHHHHHH | 42.38 | - | |
199 | Ubiquitination | IGRGQGKKNHVENLQ HHCCCCCHHHHHHHH | 60.14 | - | |
242 | Phosphorylation | NEHIKALSPVRWKVF HHHHHHHCHHHHHHE | 26.64 | 24719451 | |
285 | Ubiquitination | ETFLERHKEVSCLVP HHHHHHHHCCEEECC | 67.06 | - | |
299 | Ubiquitination | PESNQKMKDSYLILD CCCCHHHCCCEEEHH | 51.03 | - | |
354 | Phosphorylation | RGGKYVWSKADLKLD ECCEEEEECCCCCCC | 14.12 | 22817900 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RSAD2_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference |
---|---|---|---|---|
198 | K | Acetylation |
| - |
198 | K | ubiquitylation |
| - |
207 | K | ubiquitylation |
| - |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RSAD2_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
IRAK1_MOUSE | Irak1 | physical | 21435586 | |
TRAF6_MOUSE | Traf6 | physical | 21435586 | |
TRAF6_HUMAN | TRAF6 | physical | 21435586 | |
IRAK1_HUMAN | IRAK1 | physical | 21435586 | |
IRF7_MOUSE | Irf7 | physical | 21435586 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...