RS12_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RS12_DROME
• UniProt AC: P80455
• Protein Name: 40S ribosomal protein S12
• Gene Name: RpS12
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 139
• Protein Sequence: MADVDVDVPSAAPVLDGAMDINTALQEVLKKSLIADGLVHGIHQACKALDKRQAVLCILAESFDEPNYKKLVTALCNEHQIPLIRVDSHKKLGEWSGLCKIDKEGKPRKVCGCSVVVIKDFGEETPALDVVKDHLRQNS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
62	Phosphorylation	VLCILAESFDEPNYK HHHHHHHCCCCCCHH	32.18	21082442

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RS12_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RS12_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RS12_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ABDB_DROME	Abd-B	physical	14605208
SUV39_DROME	Su(var)3-9	physical	14605208
CNO10_DROME	Not10	physical	14605208
GSC_DROME	Gsc	physical	14605208
CNN_DROME	cnn	physical	14605208
MED19_DROME	MED19	physical	14605208
VND_DROME	vnd	physical	14605208
POXM_DROME	Poxm	physical	14605208

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.