UniProt ID | RS12_DROME | |
---|---|---|
UniProt AC | P80455 | |
Protein Name | 40S ribosomal protein S12 | |
Gene Name | RpS12 | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 139 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MADVDVDVPSAAPVLDGAMDINTALQEVLKKSLIADGLVHGIHQACKALDKRQAVLCILAESFDEPNYKKLVTALCNEHQIPLIRVDSHKKLGEWSGLCKIDKEGKPRKVCGCSVVVIKDFGEETPALDVVKDHLRQNS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
62 | Phosphorylation | VLCILAESFDEPNYK HHHHHHHCCCCCCHH | 32.18 | 21082442 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RS12_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RS12_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RS12_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
ABDB_DROME | Abd-B | physical | 14605208 | |
SUV39_DROME | Su(var)3-9 | physical | 14605208 | |
CNO10_DROME | Not10 | physical | 14605208 | |
GSC_DROME | Gsc | physical | 14605208 | |
CNN_DROME | cnn | physical | 14605208 | |
MED19_DROME | MED19 | physical | 14605208 | |
VND_DROME | vnd | physical | 14605208 | |
POXM_DROME | Poxm | physical | 14605208 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...