RPAB2_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RPAB2_SCHPO
• UniProt AC: P36595
• Protein Name: DNA-directed RNA polymerases I, II, and III subunit RPABC2
• Gene Name: rpb6
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 142
• Subcellular Localization: Nucleus.
• Protein Description: DNA-dependent RNA polymerases catalyze the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common component of RNA polymerases I, II and III which synthesize ribosomal RNA precursors, mRNA precursors and many functional non-coding RNAs, and small RNAs, such as 5S rRNA and tRNAs, respectively. Pol II is the central component of the basal RNA polymerase II transcription machinery. Pols are composed of mobile elements that move relative to each other. In Pol II, RPB6 is part of the clamp element and together with parts of RPB1 and RPB2 forms a pocket to which the RPB4-RPB7 subcomplex binds (By similarity)..
• Protein Sequence: MSDYEEDEAFGMDGAVMEEEVDELEMIDENGQSQQGVSHPGEPSTTVITEDVASSKTAQSGKAVAKEDRTTTPYMTKYERARILGTRALQISMNAPVLVDLEGETDPLQIAMKELAQKKIPLLVRRYLPDGSYEDWSVAELI

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
92	Phosphorylation	GTRALQISMNAPVLV CCEEEEEECCCCEEE	7.94	29996109
105	Phosphorylation	LVDLEGETDPLQIAM EEECCCCCCHHHHHH	54.49	29996109

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RPAB2_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RPAB2_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RPAB2_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TFS2_SCHPO	tfs1	genetic	10648612
RPB1_SCHPO	rpb1	physical	9642054
RPB2_SCHPO	rpb2	physical	9642054
RPB7_SCHPO	rpb7	physical	9642054
RPAB3_SCHPO	rpb8	physical	9642054
RPB1_SCHPO	rpb1	physical	9322754
RPB3_SCHPO	rpb3	physical	9322754
RPAB4_SCHPO	rpc10	physical	9322754
RPAB3_SCHPO	rpb8	physical	9322754
RPB7_SCHPO	rpb7	physical	9322754
RPB11_SCHPO	rpb11	physical	9322754
RPB2_SCHPO	rpb2	physical	9322754
RPAB1_SCHPO	rpb5	physical	9322754
RPAB5_SCHPO	rpb10	physical	9322754

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.