RPB11_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RPB11_SCHPO
• UniProt AC: P87123
• Protein Name: DNA-directed RNA polymerase II subunit RPB11
• Gene Name: rpb11
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 123
• Subcellular Localization: Nucleus.
• Protein Description: DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of RNA polymerase II which synthesizes mRNA precursors and many functional non-coding RNAs. Pol II is the central component of the basal RNA polymerase II transcription machinery. It is composed of mobile elements that move relative to each other. RPB11 is part of the core element with the central large cleft (By similarity)..
• Protein Sequence: MNQPERYELIELMGLPKVTYELDSKSPNAAVVTLEKEDHTLANMLANQLLSDERVLFAGYKVPHPLNHNFILRVQTVEDCSPKQVIVDAAKSLITHLEEIKVNFMREWELKMISVEGVEMEFS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of RPB11_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RPB11_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RPB11_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RPB11_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
RPB1_SCHPO	rpb1	physical	9642054
RPB2_SCHPO	rpb2	physical	9642054
RPB3_SCHPO	rpb3	physical	9642054

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.