RPAB4_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RPAB4_SCHPO
• UniProt AC: P48011
• Protein Name: DNA-directed RNA polymerases I, II, and III subunit RPABC4
• Gene Name: rpc10
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 63
• Subcellular Localization: Nucleus.
• Protein Description: DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common component of RNA polymerases I, II and III which synthesize ribosomal RNA precursors, mRNA precursors and many functional non-coding RNAs, and a small RNAs, such as 5S rRNA and tRNAs, respectively..
• Protein Sequence: MNHPTSTGGTAFNPPRPATMIYLCADCGARNTIQAKEVIRCRECGHRVMYKMRTKRMVQFEAR

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of RPAB4_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RPAB4_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RPAB4_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RPAB4_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
RPB1_SCHPO	rpb1	physical	9642054
RPB2_SCHPO	rpb2	physical	9642054
T2EA_SCHPO	tfa1	physical	15743411
T2FB_SCHPO	tfg2	physical	15743411
T2EB_SCHPO	tfa2	physical	15743411

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.