| UniProt ID | T2EB_SCHPO | |
|---|---|---|
| UniProt AC | P79011 | |
| Protein Name | Transcription initiation factor IIE subunit beta | |
| Gene Name | tfa2 | |
| Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
| Sequence Length | 285 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Recruits TFIIH to the initiation complex and stimulates the RNA polymerase II C-terminal domain kinase and DNA-dependent ATPase activities of TFIIH. Both TFIIH and TFIIE are required for promoter clearance by RNA polymerase (By similarity).. | |
| Protein Sequence | MSSLSDQLSSFKKKVANQPIYAKPQPRQPASPTPTAYLNSNDGHSSAASSPGSYSLKKKRSKTSLVYSQPADSGVGTHYLSQLHYAVEYLKERNEPKTAEEIASYLSTPLTPMLLNLLKKNNRIYYDERNETFTFKPLHNIRSGAGLLAYLDSQKTHVGMSIKELRDGWPNVTVELEELEKQGEVLLLRTRKDGVPKMVWRNDKSCDCHVDKEFQQVWHEIPIPPTLDLASELGKYGLKPTSVDPSTVKRAGHNQTPKQKKPKTRRGKITNTHLNILRDYSSMKP | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 31 | Phosphorylation | PQPRQPASPTPTAYL CCCCCCCCCCCCEEE | 35.67 | 24763107 | |
| 33 | Phosphorylation | PRQPASPTPTAYLNS CCCCCCCCCCEEECC | 30.67 | 21712547 | |
| 35 | Phosphorylation | QPASPTPTAYLNSND CCCCCCCCEEECCCC | 30.34 | 21712547 | |
| 46 | Phosphorylation | NSNDGHSSAASSPGS CCCCCCCCCCCCCCC | 23.37 | 24763107 | |
| 49 | Phosphorylation | DGHSSAASSPGSYSL CCCCCCCCCCCCCCC | 36.46 | 24763107 | |
| 50 | Phosphorylation | GHSSAASSPGSYSLK CCCCCCCCCCCCCCC | 28.67 | 21712547 | |
| 53 | Phosphorylation | SAASSPGSYSLKKKR CCCCCCCCCCCCCCC | 18.22 | 21712547 | |
| 256 | Phosphorylation | KRAGHNQTPKQKKPK HCCCCCCCCCCCCCC | 37.46 | 21712547 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of T2EB_SCHPO !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of T2EB_SCHPO !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of T2EB_SCHPO !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| RPB2_SCHPO | rpb2 | physical | 15743411 | |
| RPB1_SCHPO | rpb1 | physical | 15743411 | |
| PROD_SCHPO | SPCC70.03c | genetic | 22681890 | |
| YC93_SCHPO | SPCC584.03c | genetic | 22681890 | |
| YNU4_SCHPO | SPBC28E12.04 | genetic | 22681890 | |
| SEH1_SCHPO | seh1 | genetic | 22681890 | |
| YD52_SCHPO | SPAC6C3.02c | genetic | 22681890 | |
| GET1_SCHPO | get1 | genetic | 22681890 | |
| POP2_SCHPO | pop2 | genetic | 22681890 | |
| YIT2_SCHPO | SPAC105.02c | genetic | 22681890 | |
| ATP11_SCHPO | atp11 | genetic | 22681890 | |
| MU172_SCHPO | msd1 | genetic | 22681890 | |
| MUG45_SCHPO | mug45 | genetic | 22681890 | |
| PPK5_SCHPO | pom2 | genetic | 22681890 | |
| MOK11_SCHPO | mok11 | genetic | 22681890 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...