| UniProt ID | RNT2_HUMAN | |
|---|---|---|
| UniProt AC | O00584 | |
| Protein Name | Ribonuclease T2 | |
| Gene Name | RNASET2 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 256 | |
| Subcellular Localization | Secreted. Lysosome lumen. Endoplasmic reticulum lumen. Subcellular fractionation of transfected ovarian cancer cells reveals full-length RNASET2 in the endoplasmic reticulum fraction and the 2 smaller RNASET2 proteolytic products in the lysosome frac | |
| Protein Description | Has ribonuclease activity, with higher activity at acidic pH. Probably is involved in lysosomal degradation of ribosomal RNA (By similarity). Probably plays a role in cellular RNA catabolism.. | |
| Protein Sequence | MRPAALRGALLGCLCLALLCLGGADKRLRDNHEWKKLIMVQHWPETVCEKIQNDCRDPPDYWTIHGLWPDKSEGCNRSWPFNLEEIKDLLPEMRAYWPDVIHSFPNRSRFWKHEWEKHGTCAAQVDALNSQKKYFGRSLELYRELDLNSVLLKLGIKPSINYYQVADFKDALARVYGVIPKIQCLPPSQDEEVQTIGQIELCLTKQDQQLQNCTEPGEQPSPKQEVWLANGAAESRGLRVCEDGPVFYPPPKKTKH | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 76 | N-linked_Glycosylation | PDKSEGCNRSWPFNL CCCCCCCCCCCCCCH | 52.45 | 22735700 | |
| 103 | O-linked_Glycosylation | YWPDVIHSFPNRSRF HCCHHHHHCCCCHHH | 31.13 | 32574038 | |
| 106 | N-linked_Glycosylation | DVIHSFPNRSRFWKH HHHHHCCCCHHHHHC | 53.18 | 22735700 | |
| 112 | Acetylation | PNRSRFWKHEWEKHG CCCHHHHHCHHHHHC | 29.00 | 26822725 | |
| 130 | Phosphorylation | AQVDALNSQKKYFGR HHHHHHHHCHHHHCC | 44.20 | 24247654 | |
| 157 | Ubiquitination | VLLKLGIKPSINYYQ HHHHHCCCCCCCEEE | 30.80 | 2189047 | |
| 157 (in isoform 1) | Ubiquitination | - | 30.80 | 21890473 | |
| 159 | Phosphorylation | LKLGIKPSINYYQVA HHHCCCCCCCEEEEC | 20.61 | 23898821 | |
| 162 | Phosphorylation | GIKPSINYYQVADFK CCCCCCCEEEECCHH | 8.13 | 23898821 | |
| 163 | Phosphorylation | IKPSINYYQVADFKD CCCCCCEEEECCHHH | 7.63 | 23898821 | |
| 212 | N-linked_Glycosylation | KQDQQLQNCTEPGEQ HHHHHHHCCCCCCCC | 43.18 | 22735700 | |
| 214 | Phosphorylation | DQQLQNCTEPGEQPS HHHHHCCCCCCCCCC | 53.41 | 28674419 | |
| 221 | Phosphorylation | TEPGEQPSPKQEVWL CCCCCCCCCHHHEEE | 44.41 | 28674419 | |
| 235 | Phosphorylation | LANGAAESRGLRVCE ECCCCHHHCCCEECC | 27.24 | 26270265 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RNT2_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RNT2_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RNT2_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| SUCB2_HUMAN | SUCLG2 | physical | 22939629 | |
| TRAF2_HUMAN | TRAF2 | physical | 24457966 | |
| PDIA5_HUMAN | PDIA5 | physical | 26186194 | |
| FBX2_HUMAN | FBXO2 | physical | 26186194 | |
| PDIA5_HUMAN | PDIA5 | physical | 28514442 | |
| FBX2_HUMAN | FBXO2 | physical | 28514442 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| 612951 | Leukoencephalopathy, cystic, without megalencephaly (LCWM) | |||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
