RL5_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RL5_DROME
• UniProt AC: Q9W5R8
• Protein Name: 60S ribosomal protein L5
• Gene Name: RpL5
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 299
• Subcellular Localization: Cytoplasm . Nucleus .
• Protein Description: Component of the ribosome, a large ribonucleoprotein complex responsible for the synthesis of proteins in the cell. The small ribosomal subunit (SSU) binds messenger RNAs (mRNAs) and translates the encoded message by selecting cognate aminoacyl-transfer RNA (tRNA) molecules. The large subunit (LSU) contains the ribosomal catalytic site termed the peptidyl transferase center (PTC), which catalyzes the formation of peptide bonds, thereby polymerizing the amino acids delivered by tRNAs into a polypeptide chain. The nascent polypeptides leave the ribosome through a tunnel in the LSU and interact with protein factors that function in enzymatic processing, targeting, and the membrane insertion of nascent chains at the exit of the ribosomal tunnel..
• Protein Sequence: MGFVKVVKNKQYFKRYQVKFRRRREGKTDYYARKRLTFQDKNKYNTPKYRLIVRLSNKDITVQIAYARIEGDRVVCAAYSHELPKYGIQVGLTNYAAAYCTGLLVARRVLNKLGLDSLYAGCTEVTGEEFNVEPVDDGPGAFRCFLDVGLARTTTGARVFGAMKGAVDGGLNIPHSVKRFPGYSAETKSFNADVHRAHIFGQHVADYMRSLEEEDEESFKRQFSRYIKLGIRADDLEDIYKKAHQAIRNDPTHKVTAKKSSAVTKKRWNAKKLTNEQRKTKIAAHKAAYVAKLQSETEA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
5	Acetylation	---MGFVKVVKNKQY ---CCCEEEECCHHH	38.76	21791702
27	Acetylation	FRRRREGKTDYYARK EECCCCCCCCEEEEC	33.21	21791702
37	Phosphorylation	YYARKRLTFQDKNKY EEEECCCCCCCCCCC	24.23	19429919
241	Acetylation	DDLEDIYKKAHQAIR HHHHHHHHHHHHHHH	43.76	21791702
260	Phosphorylation	HKVTAKKSSAVTKKR CCCCCCCCCCCHHHH	23.87	29892262
261	Phosphorylation	KVTAKKSSAVTKKRW CCCCCCCCCCHHHHH	35.32	29892262
264	Phosphorylation	AKKSSAVTKKRWNAK CCCCCCCHHHHHCHH	30.48	29892262
292	Acetylation	HKAAYVAKLQSETEA HHHHHHHHHHHHCCC	36.69	21791702

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RL5_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RL5_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RL5_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
EF2_DROME	EF2	physical	14605208
Y678_DROME	CG2678	physical	14605208
NOI_DROME	noi	physical	14605208
VA0D1_DROME	VhaAC39-1	physical	14605208
FD3_DROME	fd59A	physical	14605208
KRI1_DROME	CG5645	physical	14605208
SCN60_DROME	NaCP60E	physical	14605208
PKRA_DROME	kra	physical	16870348

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.