RL39_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RL39_YEAST
• UniProt AC: P04650
• Protein Name: 60S ribosomal protein L39 {ECO:0000303|PubMed:9559554}
• Gene Name: RPL39 {ECO:0000303|PubMed:9559554}
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 51
• Subcellular Localization: Cytoplasm .
• Protein Description: Component of the ribosome, a large ribonucleoprotein complex responsible for the synthesis of proteins in the cell. The small ribosomal subunit (SSU) binds messenger RNAs (mRNAs) and translates the encoded message by selecting cognate aminoacyl-transfer RNA (tRNA) molecules. The large subunit (LSU) contains the ribosomal catalytic site termed the peptidyl transferase center (PTC), which catalyzes the formation of peptide bonds, thereby polymerizing the amino acids delivered by tRNAs into a polypeptide chain. The nascent polypeptides leave the ribosome through a tunnel in the LSU and interact with protein factors that function in enzymatic processing, targeting, and the membrane insertion of nascent chains at the exit of the ribosomal tunnel..
• Protein Sequence: MAAQKSFRIKQKMAKAKKQNRPLPQWIRLRTNNTIRYNAKRRNWRRTKMNI

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
5	Succinylation	---MAAQKSFRIKQK ---CCCHHHHHHHHH	47.00	23954790
6	Phosphorylation	--MAAQKSFRIKQKM --CCCHHHHHHHHHH	14.00	30377154
15	Ubiquitination	RIKQKMAKAKKQNRP HHHHHHHHHHHCCCC	58.18	22817900
17	Ubiquitination	KQKMAKAKKQNRPLP HHHHHHHHHCCCCCC	54.94	22817900
18	Ubiquitination	QKMAKAKKQNRPLPQ HHHHHHHHCCCCCCH	58.63	22817900
31	Phosphorylation	PQWIRLRTNNTIRYN CHHHHHHCCCCHHHH	37.10	30377154

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RL39_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RL39_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RL39_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
GCN20_YEAST	GCN20	physical	9234705
WTM2_YEAST	WTM2	physical	18719252
NAP1_YEAST	NAP1	physical	18719252
RIM11_YEAST	RIM11	physical	18719252
DAP2_YEAST	DAP2	physical	24072706
PSB7_YEAST	PRE4	genetic	27708008
COPD_YEAST	RET2	genetic	27708008
TMC1_YEAST	TMC1	genetic	27226598

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.