dbPTM

RL22_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	RL22_SCHPO
UniProt AC	Q09668
Protein Name	60S ribosomal protein L22
Gene Name	rpl22
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	117
Subcellular Localization
Protein Description
Protein Sequence	MVKKNTKVSNKYIIDATAAVNDKIFDVAAFEKYLIDRIKVDGKTGNLGSSVVVSREGSSKIAVIAHIDFSGRYLKYLTKKFLKKHSLRDWLRVVSTKKGVYELRYYNVVVGNDEEEQ

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
44	Phosphorylation	RIKVDGKTGNLGSSV EEEECCCCCCCCCEE	36.51	28889911
49	Phosphorylation	GKTGNLGSSVVVSRE CCCCCCCCEEEEECC	24.11	28889911
50	Phosphorylation	KTGNLGSSVVVSREG CCCCCCCEEEEECCC	19.68	28889911
54	Phosphorylation	LGSSVVVSREGSSKI CCCEEEEECCCCCCE	17.01	28889911
76	Phosphorylation	FSGRYLKYLTKKFLK CCHHHHHHHHHHHHH	19.60	25720772
95	Phosphorylation	RDWLRVVSTKKGVYE HHHHHHHHCCCCEEE	31.49	25720772
96	Phosphorylation	DWLRVVSTKKGVYEL HHHHHHHCCCCEEEE	25.76	25720772
101	Phosphorylation	VSTKKGVYELRYYNV HHCCCCEEEEEEEEE	20.22	25720772

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of RL22_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of RL22_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of RL22_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
MEX67_SCHPO	mex67	genetic	22681890
ASK1_SCHPO	ask1	genetic	22681890
RRP8_SCHPO	rrp8	genetic	22681890
YQMA_SCHPO	SPCP1E11.10	genetic	22681890
ASE1_SCHPO	ase1	genetic	22681890

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of RL22_SCHPO

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Phosphoproteome analysis of fission yeast."; Wilson-Grady J.T., Villen J., Gygi S.P.; J. Proteome Res. 7:1088-1097(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-49 AND SER-50, AND MASSSPECTROMETRY.	18257517 [Abstract]