RK_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RK_HUMAN
• UniProt AC: Q15835
• Protein Name: Rhodopsin kinase
• Gene Name: GRK1 {ECO:0000312|HGNC:HGNC:10013}
• Organism: Homo sapiens (Human).
• Sequence Length: 563
• Subcellular Localization: Membrane ; Lipid-anchor .
• Protein Description: Retina-specific kinase involved in the signal turnoff via phosphorylation of rhodopsin (RHO), the G protein- coupled receptor that initiates the phototransduction cascade. This rapid desensitization is essential for scotopic vision and permits rapid adaptation to changes in illumination..
• Protein Sequence: MDFGSLETVVANSAFIAARGSFDGSSSQPSRDKKYLAKLKLPPLSKCESLRDSLSLEFESVCLEQPIGKKLFQQFLQSAEKHLPALELWKDIEDYDTADNDLQPQKAQTILAQYLDPQAKLFCSFLDEGIVAKFKEGPVEIQDGLFQPLLQATLAHLGQAPFQEYLGSLYFLRFLQWKWLEAQPMGEDWFLDFRVLGKGGFGEVSACQMKATGKLYACKKLNKKRLKKRKGYQGAMVEKKILMKVHSRFIVSLAYAFETKADLCLVMTIMNGGDIRYHIYNVNEENPGFPEPRALFYTAQIICGLEHLHQRRIVYRDLKPENVLLDNDGNVRISDLGLAVELLDGQSKTKGYAGTPGFMAPELLQGEEYDFSVDYFALGVTLYEMIAARGPFRARGEKVENKELKHRIISEPVKYPDKFSQASKDFCEALLEKDPEKRLGFRDETCDKLRAHPLFKDLNWRQLEAGMLMPPFIPDSKTVYAKDIQDVGAFSTVKGVAFDKTDTEFFQEFATGNCPIPWQEEMIETGIFGELNVWRSDGQMPDDMKGISGGSSSSSKSGMCLVS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of RK_HUMAN !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RK_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RK_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RK_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
OPSD_HUMAN	RHO	physical	8617805
RECO_HUMAN	RCVRN	physical	9753452
SYUA_HUMAN	SNCA	physical	10852916
SYUB_HUMAN	SNCB	physical	10852916
SYUG_HUMAN	SNCG	physical	10852916
H2AV_HUMAN	H2AFV	physical	25852190

Drug and Disease Associations

• Kegg Disease
• H00787: Congenital stationary night blindness (CSNB), including: CSNB type 1 (CSNB1); CSNB type 2 (CSNB2); C
• OMIM Disease
• 613411: Night blindness, congenital stationary, Oguchi type 2 (CSNBO2)
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.