UniProt ID | SYUB_HUMAN | |
---|---|---|
UniProt AC | Q16143 | |
Protein Name | Beta-synuclein | |
Gene Name | SNCB | |
Organism | Homo sapiens (Human). | |
Sequence Length | 134 | |
Subcellular Localization | Cytoplasm. | |
Protein Description | Non-amyloid component of senile plaques found in Alzheimer disease. Could act as a regulator of SNCA aggregation process. Protects neurons from staurosporine and 6-hydroxy dopamine (6OHDA)-stimulated caspase activation in a p53/TP53-dependent manner. Contributes to restore the SNCA anti-apoptotic function abolished by 6OHDA. Not found in the Lewy bodies associated with Parkinson disease.. | |
Protein Sequence | MDVFMKGLSMAKEGVVAAAEKTKQGVTEAAEKTKEGVLYVGSKTREGVVQGVASVAEKTKEQASHLGGAVFSGAGNIAAATGLVKREEFPTDLKPEEVAQEAAEEPLIEPLMEPEGESYEDPPQEEYQEYEPEA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
6 | Acetylation | --MDVFMKGLSMAKE --CCCCHHHHHHHHH | 45.28 | 130393 | |
12 | Acetylation | MKGLSMAKEGVVAAA HHHHHHHHHHHHHHH | 46.49 | 71019 | |
21 | Acetylation | GVVAAAEKTKQGVTE HHHHHHHHHCCCHHH | 57.19 | - | |
27 | O-linked_Glycosylation | EKTKQGVTEAAEKTK HHHCCCHHHHHHHHC | 27.08 | 28657654 | |
39 | Phosphorylation | KTKEGVLYVGSKTRE HHCCCEEEECCCCCC | 10.60 | 21945579 | |
42 | Phosphorylation | EGVLYVGSKTREGVV CCEEEECCCCCCCCH | 22.32 | 21945579 | |
54 | O-linked_Glycosylation | GVVQGVASVAEKTKE CCHHHHHHHHHHHHH | 21.32 | 28657654 | |
59 | O-linked_Glycosylation | VASVAEKTKEQASHL HHHHHHHHHHHHHHH | 31.17 | 28657654 | |
118 | Phosphorylation | LMEPEGESYEDPPQE CCCCCCCCCCCCCHH | 44.68 | 22817900 | |
127 | Phosphorylation | EDPPQEEYQEYEPEA CCCCHHHHHHHCCCC | 13.09 | 21699177 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
118 | S | Phosphorylation | Kinase | ADRBK1 | P25098 | GPS |
118 | S | Phosphorylation | Kinase | GRK5 | P34947 | Uniprot |
118 | S | Phosphorylation | Kinase | PLK1 | P53350 | PSP |
118 | S | Phosphorylation | Kinase | PLK2 | Q9NYY3 | PSP |
118 | S | Phosphorylation | Kinase | PLK3 | Q9H4B4 | PSP |
118 | S | Phosphorylation | Kinase | CK2-FAMILY | - | GPS |
118 | S | Phosphorylation | Kinase | CK2 | - | Uniprot |
127 | Y | Phosphorylation | Kinase | CHEK1 | O14757 | GPS |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SYUB_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SYUB_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SYUA_HUMAN | SNCA | physical | 11683992 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...