SYUB_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SYUB_HUMAN
• UniProt AC: Q16143
• Protein Name: Beta-synuclein
• Gene Name: SNCB
• Organism: Homo sapiens (Human).
• Sequence Length: 134
• Subcellular Localization: Cytoplasm.
• Protein Description: Non-amyloid component of senile plaques found in Alzheimer disease. Could act as a regulator of SNCA aggregation process. Protects neurons from staurosporine and 6-hydroxy dopamine (6OHDA)-stimulated caspase activation in a p53/TP53-dependent manner. Contributes to restore the SNCA anti-apoptotic function abolished by 6OHDA. Not found in the Lewy bodies associated with Parkinson disease..
• Protein Sequence: MDVFMKGLSMAKEGVVAAAEKTKQGVTEAAEKTKEGVLYVGSKTREGVVQGVASVAEKTKEQASHLGGAVFSGAGNIAAATGLVKREEFPTDLKPEEVAQEAAEEPLIEPLMEPEGESYEDPPQEEYQEYEPEA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
6	Acetylation	--MDVFMKGLSMAKE --CCCCHHHHHHHHH	45.28	130393
12	Acetylation	MKGLSMAKEGVVAAA HHHHHHHHHHHHHHH	46.49	71019
21	Acetylation	GVVAAAEKTKQGVTE HHHHHHHHHCCCHHH	57.19	-
27	O-linked_Glycosylation	EKTKQGVTEAAEKTK HHHCCCHHHHHHHHC	27.08	28657654
39	Phosphorylation	KTKEGVLYVGSKTRE HHCCCEEEECCCCCC	10.60	21945579
42	Phosphorylation	EGVLYVGSKTREGVV CCEEEECCCCCCCCH	22.32	21945579
54	O-linked_Glycosylation	GVVQGVASVAEKTKE CCHHHHHHHHHHHHH	21.32	28657654
59	O-linked_Glycosylation	VASVAEKTKEQASHL HHHHHHHHHHHHHHH	31.17	28657654
118	Phosphorylation	LMEPEGESYEDPPQE CCCCCCCCCCCCCHH	44.68	22817900
127	Phosphorylation	EDPPQEEYQEYEPEA CCCCHHHHHHHCCCC	13.09	21699177

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
118	S	Phosphorylation	Kinase	ADRBK1	P25098	GPS
118	S	Phosphorylation	Kinase	GRK5	P34947	Uniprot
118	S	Phosphorylation	Kinase	PLK1	P53350	PSP
118	S	Phosphorylation	Kinase	PLK2	Q9NYY3	PSP
118	S	Phosphorylation	Kinase	PLK3	Q9H4B4	PSP
118	S	Phosphorylation	Kinase	CK2-FAMILY	-	GPS
118	S	Phosphorylation	Kinase	CK2	-	Uniprot
127	Y	Phosphorylation	Kinase	CHEK1	O14757	GPS

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SYUB_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SYUB_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SYUA_HUMAN	SNCA	physical	11683992

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.