RDM1_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RDM1_ARATH
• UniProt AC: Q9LUJ3
• Protein Name: Protein RDM1
• Gene Name: RDM1
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 163
• Subcellular Localization: Nucleus, nucleoplasm . Peri-nucleolar.
• Protein Description: Regulator of RNA-directed DNA methylation (RdDM). Binds to single-stranded methyl DNA. Involved in the assembly of RNA polymerase V (Pol V) transcription initiation or elongation complexes at the chromatin, as a component of the DDR complex..
• Protein Sequence: MQSSMTMELRPSGDSGSSDVDAEISDGFSPLDTSHRDVADEGSLLRRAEMYQDYMKQVPIPTNRGSLIPFTSWVGLSISMKQLYGQPLHYLTNVLLQRWDQSRFGTDSEEQRLDSIIHPTKAEATIWLVEEIHRLTPSHLHMALLWRSDPMYHSFIDPIFPEK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of RDM1_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RDM1_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RDM1_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RDM1_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
AGO4_ARATH	AGO4	physical	20410883
DRM2_ARATH	DRM2	physical	20410883
NRPB1_ARATH	NRPB1	physical	20410883
RDM1_ARATH	RDM1	physical	24498436
DMS3_ARATH	DMS3	physical	24498436

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.