UniProt ID | RDM1_ARATH | |
---|---|---|
UniProt AC | Q9LUJ3 | |
Protein Name | Protein RDM1 | |
Gene Name | RDM1 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 163 | |
Subcellular Localization | Nucleus, nucleoplasm . Peri-nucleolar. | |
Protein Description | Regulator of RNA-directed DNA methylation (RdDM). Binds to single-stranded methyl DNA. Involved in the assembly of RNA polymerase V (Pol V) transcription initiation or elongation complexes at the chromatin, as a component of the DDR complex.. | |
Protein Sequence | MQSSMTMELRPSGDSGSSDVDAEISDGFSPLDTSHRDVADEGSLLRRAEMYQDYMKQVPIPTNRGSLIPFTSWVGLSISMKQLYGQPLHYLTNVLLQRWDQSRFGTDSEEQRLDSIIHPTKAEATIWLVEEIHRLTPSHLHMALLWRSDPMYHSFIDPIFPEK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of RDM1_ARATH !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RDM1_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RDM1_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RDM1_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
AGO4_ARATH | AGO4 | physical | 20410883 | |
DRM2_ARATH | DRM2 | physical | 20410883 | |
NRPB1_ARATH | NRPB1 | physical | 20410883 | |
RDM1_ARATH | RDM1 | physical | 24498436 | |
DMS3_ARATH | DMS3 | physical | 24498436 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...