| UniProt ID | RDM1_ARATH | |
|---|---|---|
| UniProt AC | Q9LUJ3 | |
| Protein Name | Protein RDM1 | |
| Gene Name | RDM1 | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 163 | |
| Subcellular Localization | Nucleus, nucleoplasm . Peri-nucleolar. | |
| Protein Description | Regulator of RNA-directed DNA methylation (RdDM). Binds to single-stranded methyl DNA. Involved in the assembly of RNA polymerase V (Pol V) transcription initiation or elongation complexes at the chromatin, as a component of the DDR complex.. | |
| Protein Sequence | MQSSMTMELRPSGDSGSSDVDAEISDGFSPLDTSHRDVADEGSLLRRAEMYQDYMKQVPIPTNRGSLIPFTSWVGLSISMKQLYGQPLHYLTNVLLQRWDQSRFGTDSEEQRLDSIIHPTKAEATIWLVEEIHRLTPSHLHMALLWRSDPMYHSFIDPIFPEK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of RDM1_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RDM1_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RDM1_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RDM1_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| AGO4_ARATH | AGO4 | physical | 20410883 | |
| DRM2_ARATH | DRM2 | physical | 20410883 | |
| NRPB1_ARATH | NRPB1 | physical | 20410883 | |
| RDM1_ARATH | RDM1 | physical | 24498436 | |
| DMS3_ARATH | DMS3 | physical | 24498436 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...