UniProt ID | DMS3_ARATH | |
---|---|---|
UniProt AC | Q94A79 | |
Protein Name | Protein DEFECTIVE IN MERISTEM SILENCING 3 | |
Gene Name | DMS3 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 420 | |
Subcellular Localization | Nucleus . | |
Protein Description | Component of the RNA-directed DNA methylation (RdDM) machinery, probably by facilitating an RNAi-mediated epigenetic modification involving secondary siRNAs and spreading of DNA methylation, thus leading to gene silencing. Involved in the assembly of RNA polymerase V (Pol V) transcription initiation or elongation complexes at the chromatin, as a component of the DDR complex. Required for de novo DNA methylation.. | |
Protein Sequence | MYPTGQQISFQTTPLNVQDPTRMMNLDQSSPVARNETQNGGGIAHAEFAMFNSKRLESDLEAMGNKIKQHEDNLKFLKSQKNKMDEAIVDLQVHMSKLNSSPTPRSENSDNSLQGEDINAQILRHENSAAGVLSLVETLHGAQASQLMLTKGVVGVVAKLGKVNDENLSQILSNYLGTRSMLAVVCRNYESVTALEAYDNHGNIDINAGLHCLGSSIGREIGDSFDAICLENLRPYVGQHIADDLQRRLDLLKPKLPNGECPPGFLGFAVNMIQIDPAYLLCVTSYGYGLRETLFYNLFSRLQVYKTRADMISALPCISDGAVSLDGGIIRKTGIFNLGNRDEVNVRFAKPTASRTMDNYSEAEKKMKELKWKKEKTLEDIKREQVLREHAVFNFGKKKEEFVRCLAQSSCTNQPMNTPR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
29 | Phosphorylation | RMMNLDQSSPVARNE CCCCCCCCCCCCCCC | 23776212 | ||
30 | Phosphorylation | MMNLDQSSPVARNET CCCCCCCCCCCCCCC | 23776212 | ||
100 | Phosphorylation | VHMSKLNSSPTPRSE HHHHHCCCCCCCCCC | 25561503 | ||
101 | Phosphorylation | HMSKLNSSPTPRSEN HHHHCCCCCCCCCCC | 25561503 | ||
103 | Phosphorylation | SKLNSSPTPRSENSD HHCCCCCCCCCCCCC | 25561503 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DMS3_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DMS3_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DMS3_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
RDM1_ARATH | RDM1 | physical | 20409711 | |
NRPE1_ARATH | NRPD1B | physical | 20409711 | |
NRPD2_ARATH | NRPD2A | physical | 20409711 | |
NRPB3_ARATH | NRPB3 | physical | 20409711 | |
SINA3_ARATH | AT3G61790 | physical | 21798944 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...