UniProt ID | RDL1_SCHPO | |
---|---|---|
UniProt AC | O13800 | |
Protein Name | DNA repair protein rdl1 | |
Gene Name | rdl1 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 230 | |
Subcellular Localization | Cytoplasm. Nucleus. | |
Protein Description | Involved in homologous recombination where it functions at an early stage of recombination in a pre-recombinogenic complex with rlp1 and sws1. Also has a role at a later stage of recombination in association with the rhp55-rhp57 complex.. | |
Protein Sequence | MNQVTQFSGNSANLMLYWILKSYYSRFDRIMWIDTLGTFNPAALPLPCLEKTMLVRSFDAQGLKDAVDELESNLKSSEDQAYALCIDSFSNPIGLLMAQGNISFAHAFMMTLGRKCRILTRKFRLAVYLSTSLVYIKQLHLSKPALGNSWPFCLDHSYILEDQQHNKCLVHCNQSRKDLLGCSQLFLLLKGSFTHEYLTIDFYNGTPVSVSSKLHVSPSLYHSSTLNSPS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
217 | Phosphorylation | VSSKLHVSPSLYHSS ECCEEEECCHHHCCC | 9.68 | 24763107 | |
219 | Phosphorylation | SKLHVSPSLYHSSTL CEEEECCHHHCCCCC | 33.77 | 21712547 | |
221 | Phosphorylation | LHVSPSLYHSSTLNS EEECCHHHCCCCCCC | 12.18 | 21712547 | |
223 | Phosphorylation | VSPSLYHSSTLNSPS ECCHHHCCCCCCCCC | 16.09 | 21712547 | |
224 | Phosphorylation | SPSLYHSSTLNSPS- CCHHHCCCCCCCCC- | 24.49 | 24763107 | |
225 | Phosphorylation | PSLYHSSTLNSPS-- CHHHCCCCCCCCC-- | 32.73 | 21712547 | |
228 | Phosphorylation | YHSSTLNSPS----- HCCCCCCCCC----- | 29.63 | 21712547 | |
230 | Phosphorylation | SSTLNSPS------- CCCCCCCC------- | 53.31 | 24763107 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RDL1_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RDL1_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RDL1_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
RAD1_SCHPO | rad1 | genetic | 18818364 | |
JMJ1_SCHPO | jmj1 | genetic | 18818364 | |
YEC6_SCHPO | pcf3 | genetic | 18818364 | |
COPE_SCHPO | sec28 | genetic | 18818364 | |
RYH1_SCHPO | ryh1 | genetic | 18818364 | |
FBH1_SCHPO | fbh1 | genetic | 18818364 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...