dbPTM

YEC6_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	YEC6_SCHPO
UniProt AC	Q9Y825
Protein Name	Uncharacterized WD repeat-containing protein C25H1.06
Gene Name	SPAC25H1.06
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	408
Subcellular Localization	Cytoplasm .
Protein Description
Protein Sequence	MNTELDMQNFEHIKFLENQISEDHFRWKKNSKHLYNLLITRTLTWPSLSIQWLSAMESITEKAVLKNRLLLGTHAAEGMPNFLQLADLDLPDFNQTILDPVKHYNEDTGELGGYSMQHSCKFQISQRILHNGDVNRVRHMPQNPNIIATMSSCGNAYIFDRTKYTSMPAEEFLPNISLIGHKKEGFGLSWNRQQNCRLVTAANDSKILEWDLNNFSRDTRCLTPVKDFHYDDSPVNDVEYHPHHTNLYIAVNDNGIAFICDNRLQQTCSKTVKASNPLFSVRHNPSIATLFALGSEQDLQLWDLRNLNKSVFNTSEDLSDNRLKVPSRLTLGGTSLSWSWRHSGRIVSACQEYCYVWNFNKANPLEFVHAGHKGTVNEVDFDPFEAQCIASVADDNELHIWKPNVIVN

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of YEC6_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of YEC6_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of YEC6_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of YEC6_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
RLF2_SCHPO	pcf1	physical	21211723
YEG3_SCHPO	pcf2	physical	21211723
PCNA_SCHPO	pcn1	physical	21211723
RAD9_SCHPO	rad9	genetic	18818364
RAD26_SCHPO	rad26	genetic	18818364
TRM61_SCHPO	cpd1	genetic	18818364
RAP1_SCHPO	rap1	genetic	18818364
HIR1_SCHPO	hip1	genetic	18818364
POB3_SCHPO	pob3	genetic	18818364
HPC2_SCHPO	hip4	genetic	18818364
JHD1_SCHPO	epe1	genetic	18818364

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of YEC6_SCHPO

Related Literatures of Post-Translational Modification