UniProt ID | YEC6_SCHPO | |
---|---|---|
UniProt AC | Q9Y825 | |
Protein Name | Uncharacterized WD repeat-containing protein C25H1.06 | |
Gene Name | SPAC25H1.06 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 408 | |
Subcellular Localization | Cytoplasm . | |
Protein Description | ||
Protein Sequence | MNTELDMQNFEHIKFLENQISEDHFRWKKNSKHLYNLLITRTLTWPSLSIQWLSAMESITEKAVLKNRLLLGTHAAEGMPNFLQLADLDLPDFNQTILDPVKHYNEDTGELGGYSMQHSCKFQISQRILHNGDVNRVRHMPQNPNIIATMSSCGNAYIFDRTKYTSMPAEEFLPNISLIGHKKEGFGLSWNRQQNCRLVTAANDSKILEWDLNNFSRDTRCLTPVKDFHYDDSPVNDVEYHPHHTNLYIAVNDNGIAFICDNRLQQTCSKTVKASNPLFSVRHNPSIATLFALGSEQDLQLWDLRNLNKSVFNTSEDLSDNRLKVPSRLTLGGTSLSWSWRHSGRIVSACQEYCYVWNFNKANPLEFVHAGHKGTVNEVDFDPFEAQCIASVADDNELHIWKPNVIVN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of YEC6_SCHPO !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YEC6_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YEC6_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YEC6_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
RLF2_SCHPO | pcf1 | physical | 21211723 | |
YEG3_SCHPO | pcf2 | physical | 21211723 | |
PCNA_SCHPO | pcn1 | physical | 21211723 | |
RAD9_SCHPO | rad9 | genetic | 18818364 | |
RAD26_SCHPO | rad26 | genetic | 18818364 | |
TRM61_SCHPO | cpd1 | genetic | 18818364 | |
RAP1_SCHPO | rap1 | genetic | 18818364 | |
HIR1_SCHPO | hip1 | genetic | 18818364 | |
POB3_SCHPO | pob3 | genetic | 18818364 | |
HPC2_SCHPO | hip4 | genetic | 18818364 | |
JHD1_SCHPO | epe1 | genetic | 18818364 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...