dbPTM

RAP22_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	RAP22_ARATH
UniProt AC	Q9LUM4
Protein Name	Ethylene-responsive transcription factor RAP2-2
Gene Name	RAP2-2
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	379
Subcellular Localization	Nucleus .
Protein Description	Transcription factor involved in carotenoid biosynthesis regulation. Binds to the 5'-ATCTA-3' element present in the promoter of phytoene synthase (PSY) and phytoene desaturase (PDS). Involved in ethylene response and resistance to necrotrophic pathogens. Acts as a downstream regulator in the ethylene signaling pathway. Partially redundant with RAP2-12..
Protein Sequence	MCGGAIISDFIPPPRSLRVTNEFIWPDLKNKVKASKKRSNKRSDFFDLDDDFEADFQGFKDDSAFDCEDDDDVFVNVKPFVFTATTKPVASAFVSTGIYLVGSAYAKKTVESAEQAEKSSKRKRKNQYRGIRQRPWGKWAAEIRDPRKGSREWLGTFDTAEEAARAYDAAARRIRGTKAKVNFPEEKNPSVVSQKRPSAKTNNLQKSVAKPNKSVTLVQQPTHLSQQYCNNSFDNSFGDMSFMEEKPQMYNNQFGLTNSFDAGGNNGYQYFSSDQGSNSFDCSEFGWSDHGPKTPEISSMLVNNNEASFVEETNAAKKLKPNSDESDDLMAYLDNALWDTPLEVEAMLGADAGAVTQEEENPVELWSLDEINFMLEGDF

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of RAP22_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of RAP22_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of RAP22_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of RAP22_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SINA2_ARATH	SINAT2	physical	17873090
BCAT2_ARATH	BCAT-2	physical	24823379
ERF79_ARATH	ERF8	physical	24823379
CIPKB_ARATH	SIP4	physical	24823379
CIPKE_ARATH	SR1	physical	24823379
NADB_ARATH	AO	physical	24823379
P2C78_ARATH	HAI1	physical	24823379

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of RAP22_ARATH

Related Literatures of Post-Translational Modification