dbPTM

BCAT2_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	BCAT2_ARATH
UniProt AC	Q9M439
Protein Name	Branched-chain-amino-acid aminotransferase 2, chloroplastic
Gene Name	BCAT2
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	388
Subcellular Localization	Plastid, chloroplast.
Protein Description	Converts 2-oxo acids to branched-chain amino acids. Shows activity with L-Leu, L-Ile and L-Val as amino donors and 2-oxoglutarate as an amino acceptor, but no activity for D-isomers of Leu, Ile, Val, Asp, Glu or Ala..
Protein Sequence	MIKTITSLRKTLVLPLHLHIRTLQTFAKYNAQAASALREERKKPLYQNGDDVYADLDWDNLGFGLNPADYMYVMKCSKDGEFTQGELSPYGNIQLSPSAGVLNYGQAIYEGTKAYRKENGKLLLFRPDHNAIRMKLGAERMLMPSPSVDQFVNAVKQTALANKRWVPPAGKGTLYIRPLLMGSGPILGLGPAPEYTFIVYASPVGNYFKEGMAALNLYVEEEYVRAAPGGAGGVKSITNYAPVLKALSRAKSRGFSDVLYLDSVKKKYLEEASSCNVFVVKGRTISTPATNGTILEGITRKSVMEIASDQGYQVVEKAVHVDEVMDADEVFCTGTAVVVAPVGTITYQEKRVEYKTGDESVCQKLRSVLVGIQTGLIEDNKGWVTDIN

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
235	N6-(pyridoxal phosphate)lysine	PGGAGGVKSITNYAP CCCCCCHHHHHCHHH	39.14	-
235	Other	PGGAGGVKSITNYAP CCCCCCHHHHHCHHH	39.14	-
284	Phosphorylation	VFVVKGRTISTPATN EEEEECCEECCCCCC	28.13	19880383
286	Phosphorylation	VVKGRTISTPATNGT EEECCEECCCCCCCC	27.94	19880383
290	Phosphorylation	RTISTPATNGTILEG CEECCCCCCCCEEEC	35.07	19880383
299	Phosphorylation	GTILEGITRKSVMEI CCEEECCCHHHHHHH	42.79	19880383

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of BCAT2_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of BCAT2_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of BCAT2_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
ASIL1_ARATH	ASIL1	physical	21798944

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of BCAT2_ARATH

Related Literatures of Post-Translational Modification