UniProt ID | BCAT2_ARATH | |
---|---|---|
UniProt AC | Q9M439 | |
Protein Name | Branched-chain-amino-acid aminotransferase 2, chloroplastic | |
Gene Name | BCAT2 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 388 | |
Subcellular Localization | Plastid, chloroplast. | |
Protein Description | Converts 2-oxo acids to branched-chain amino acids. Shows activity with L-Leu, L-Ile and L-Val as amino donors and 2-oxoglutarate as an amino acceptor, but no activity for D-isomers of Leu, Ile, Val, Asp, Glu or Ala.. | |
Protein Sequence | MIKTITSLRKTLVLPLHLHIRTLQTFAKYNAQAASALREERKKPLYQNGDDVYADLDWDNLGFGLNPADYMYVMKCSKDGEFTQGELSPYGNIQLSPSAGVLNYGQAIYEGTKAYRKENGKLLLFRPDHNAIRMKLGAERMLMPSPSVDQFVNAVKQTALANKRWVPPAGKGTLYIRPLLMGSGPILGLGPAPEYTFIVYASPVGNYFKEGMAALNLYVEEEYVRAAPGGAGGVKSITNYAPVLKALSRAKSRGFSDVLYLDSVKKKYLEEASSCNVFVVKGRTISTPATNGTILEGITRKSVMEIASDQGYQVVEKAVHVDEVMDADEVFCTGTAVVVAPVGTITYQEKRVEYKTGDESVCQKLRSVLVGIQTGLIEDNKGWVTDIN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
235 | N6-(pyridoxal phosphate)lysine | PGGAGGVKSITNYAP CCCCCCHHHHHCHHH | 39.14 | - | |
235 | Other | PGGAGGVKSITNYAP CCCCCCHHHHHCHHH | 39.14 | - | |
284 | Phosphorylation | VFVVKGRTISTPATN EEEEECCEECCCCCC | 28.13 | 19880383 | |
286 | Phosphorylation | VVKGRTISTPATNGT EEECCEECCCCCCCC | 27.94 | 19880383 | |
290 | Phosphorylation | RTISTPATNGTILEG CEECCCCCCCCEEEC | 35.07 | 19880383 | |
299 | Phosphorylation | GTILEGITRKSVMEI CCEEECCCHHHHHHH | 42.79 | 19880383 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of BCAT2_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of BCAT2_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of BCAT2_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
ASIL1_ARATH | ASIL1 | physical | 21798944 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...