RAN_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RAN_DROME
• UniProt AC: Q9VZ23
• Protein Name: GTP-binding nuclear protein Ran
• Gene Name: Ran {ECO:0000312|FlyBase:FBgn0020255}
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 216
• Subcellular Localization: Nucleus . Nucleus envelope . Cytoplasm . Cytoplasm, cytoskeleton, spindle . Localizes around the microtubule spindle during mitosis.
• Protein Description: GTPase involved in nucleocytoplasmic transport, participating both to the import and the export from the nucleus of proteins and RNAs. Switches between a cytoplasmic GDP- and a nuclear GTP-bound state by nucleotide exchange and GTP hydrolysis. Nuclear import receptors such as importin beta bind their substrates only in the absence of GTP-bound RAN and release them upon direct interaction with GTP-bound RAN, while export receptors behave in the opposite way. Thereby, RAN controls cargo loading and release by transport receptors in the proper compartment and ensures the directionality of the transport. Interaction with RANBP1 induces a conformation change in the complex formed by XPO1 and RAN that triggers the release of the nuclear export signal of cargo proteins. RAN (GTP-bound form) triggers microtubule assembly at mitotic chromosomes and is required for normal mitotic spindle assembly and chromosome segregation. Required for normal progress through mitosis (By similarity). GTP-bound Ran modulates both spindle and nuclear envelope assembly, supporting a role during mitosis. [PubMed: 12121620]
• Protein Sequence: MAQEGQDIPTFKCVLVGDGGTGKTTFVKRHMTGEFEKKYVATLGVEVHPLIFHTNRGAIRFNVWDTAGQEKFGGLRDGYYIQGQCAVIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLVGDPNLEFVAMPALLPPEVKMDKDWQAQIERDLQEAQATALPDEDEEL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
71	Acetylation	WDTAGQEKFGGLRDG EECCCCCCCCCCCCC	41.23	21791702
99	Acetylation	VTSRVTYKNVPNWHR CCCCCEECCCCCHHH	41.94	21791702
135	Phosphorylation	DRKVKAKSIVFHRKK CCEEECEEEEEEECC	28.92	19429919
191	Acetylation	PPEVKMDKDWQAQIE CCCCCCCHHHHHHHH	58.32	21791702
207	Phosphorylation	DLQEAQATALPDEDE HHHHHHHHCCCCCCC	19.35	21082442

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RAN_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RAN_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RAN_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
KPYK_DROME	PyK	physical	14605208
CH36_DROME	Cp36	physical	14605208
SUB_DROME	sub	genetic	22100918

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.