CH36_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CH36_DROME
• UniProt AC: P07182
• Protein Name: Chorion protein S36
• Gene Name: Cp36
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 284
• Subcellular Localization: Secreted.
• Protein Description: Chorion membrane (egg shell) protein; plays a role in protecting the egg from the environment..
• Protein Sequence: MQLGLWFGILAIAATPLVSANYGPAGGHGHGHGHGQYLSGPNAGLEEYVNVASGGNQQAANQIASQAEIQPTPEEARRLGRVQAQLQALNADPNYQKLKNSEDIAESLAETNLASNIRQGKIKVVSPQFVDQHLFRSLLVPSGHNNHQVIATQPLPPIIVHQPGAPPAHVNSGPPTVVRGNPVIYKIKPSVIYQQEVINKVPTPLSLNPVYVKVYKPGKKIEAPLAPVVAPVYSQPREYSQPQGYGSAGAASSAAGAASSADGNAYGNEAPLYNSPAPYGQPNY

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of CH36_DROME !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CH36_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CH36_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CH36_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
OAZ_DROME	Oda	physical	14605208
CEG1A_DROME	CenG1A	physical	14605208
MTND_DROME	CG32068	physical	14605208
RS3_DROME	RpS3	physical	14605208
LARK_DROME	lark	physical	14605208
RS11_DROME	RpS11	physical	14605208

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.