PXG3_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: PXG3_ARATH
• UniProt AC: O22788
• Protein Name: Probable peroxygenase 3
• Gene Name: PXG3
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 236
• Subcellular Localization: Microsome membrane. Plastid, chloroplast membrane. Lipid droplet.
• Protein Description: Probable calcium-binding peroxygenase. May be involved in the degradation of storage lipid in oil bodies, in abiotic stress-related signaling pathway and in drought tolerance through stomatal control under water deficit conditions..
• Protein Sequence: MAGEAEALATTAPLAPVTSQRKVRNDLEETLPKPYMARALAAPDTEHPNGTEGHDSKGMSVMQQHVAFFDQNDDGIVYPWETYKGFRDLGFNPISSIFWTLLINLAFSYVTLPSWVPSPLLPVYIDNIHKAKHGSDSSTYDTEGRYVPVNLENIFSKYALTVKDKLSFKEVWNVTEGNRMAIDPFGWLSNKVEWILLYILAKDEDGFLSKEAVRGCFDGSLFEQIAKERANSRKQD

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MAGEAEALA ------CCCHHHHHH	25.24	22223895
220	Phosphorylation	VRGCFDGSLFEQIAK HCCCCCHHHHHHHHH	31.56	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of PXG3_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of PXG3_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of PXG3_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CIPKB_ARATH	SIP4	physical	24823379
ABI5_ARATH	ABI5	physical	24823379
CIPKE_ARATH	SR1	physical	24823379
RVE2_ARATH	RVE2	physical	24823379

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.