UniProt ID | PTPS_DROME | |
---|---|---|
UniProt AC | P48611 | |
Protein Name | 6-pyruvoyl tetrahydrobiopterin synthase | |
Gene Name | pr | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 168 | |
Subcellular Localization | ||
Protein Description | Required for pigment and biopterin synthesis.. | |
Protein Sequence | MSQQPVAFLTRRETFSACHRLHSPQLSDAENLEVFGKCNNFHGHGHNYTVEITVRGPIDRRTGMVLNITELKEAIETVIMKRLDHKNLDKDVEYFANTPSTTENLAVYIWDNIRLQLKKPELLYEVKIHETPKNIISYRGPYPLNGIYNPINKRIAHDSCTNISSDSD | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
14 | Phosphorylation | AFLTRRETFSACHRL EEHHHHHHHHHHHHC | 22.52 | 22817900 | |
23 | Phosphorylation | SACHRLHSPQLSDAE HHHHHCCCCCCCCHH | 20.95 | 19429919 | |
81 | Ubiquitination | AIETVIMKRLDHKNL HHHHHHHHCCCCCCC | 38.39 | 31113955 | |
148 | Phosphorylation | PYPLNGIYNPINKRI CCCCCCCCCCCCCCC | 19.11 | 18281928 | |
159 | Phosphorylation | NKRIAHDSCTNISSD CCCCCCHHCCCCCCC | 16.99 | 22817900 | |
161 | Phosphorylation | RIAHDSCTNISSDSD CCCCHHCCCCCCCCC | 39.27 | 22817900 | |
164 | Phosphorylation | HDSCTNISSDSD--- CHHCCCCCCCCC--- | 30.11 | 19429919 | |
165 | Phosphorylation | DSCTNISSDSD---- HHCCCCCCCCC---- | 37.02 | 19429919 | |
167 | Phosphorylation | CTNISSDSD------ CCCCCCCCC------ | 47.36 | 19429919 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PTPS_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PTPS_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PTPS_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
PTPS_DROME | pr | physical | 14605208 | |
TPIS_DROME | Tpi | physical | 22036573 | |
AN32A_DROME | Mapmodulin | physical | 22036573 | |
SUS_DROME | su(s) | genetic | 8846895 | |
WHITE_DROME | w | genetic | 11962627 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Phosphoproteome analysis of Drosophila melanogaster embryos."; Zhai B., Villen J., Beausoleil S.A., Mintseris J., Gygi S.P.; J. Proteome Res. 7:1675-1682(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-159; THR-161; SER-164;SER-165 AND SER-167, AND MASS SPECTROMETRY. |