UniProt ID | AN32A_DROME | |
---|---|---|
UniProt AC | Q9V895 | |
Protein Name | Acidic leucine-rich nuclear phosphoprotein 32 family member A | |
Gene Name | Anp32a | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 261 | |
Subcellular Localization | Nucleus. Cytoplasm. Shuttles between nucleus and cytoplasm.. | |
Protein Description | Implicated in a number of cellular processes, including proliferation, differentiation, caspase-dependent and caspase-independent apoptosis, suppression of transformation (tumor suppressor), inhibition of protein phosphatase 2A, regulation of mRNA trafficking and stability, and inhibition of acetyltransferases as part of the INHAT (inhibitor of histone acetyltransferases) complex.. | |
Protein Sequence | MEKRIELERRARKVNQITELNLDNCRSTSIVGLTDEYTALESLSLINVGLTTLKGFPKLPNLKKLELSDNRISSGLNYLTTSPKLQYLNLSGNKIKDLETLKPLEEFKNLVVLDLFNNDATQVDNYREKIFKMLPSLNFLDGFDCNDEEVQSDGDDDDEVNGNDSDEVGVSDEDDDSDDSDEEANGEVSLSEVYNDDLEEDNSDWEGEDEAGEEDEEEDSDIDDADGDANESAASVNAKDKDGEKEADESQVRGKKRKHDG | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
102 | Acetylation | IKDLETLKPLEEFKN CCCHHHCCCHHHHHC | 55.78 | 21791702 | |
152 | Phosphorylation | CNDEEVQSDGDDDDE CCCHHHCCCCCCCCC | 49.05 | 19060867 | |
152 (in isoform 2) | Phosphorylation | - | 49.05 | 21082442 | |
165 (in isoform 2) | Phosphorylation | - | 39.40 | 21082442 | |
250 | Phosphorylation | GEKEADESQVRGKKR CCCCCCHHHHCCCCC | 34.23 | 21082442 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of AN32A_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of AN32A_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of AN32A_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
AGT2L_DROME | CG8745 | physical | 22036573 | |
TPIS_DROME | Tpi | physical | 22036573 | |
RUVB1_DROME | pont | physical | 22036573 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...