AN32A_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: AN32A_DROME
• UniProt AC: Q9V895
• Protein Name: Acidic leucine-rich nuclear phosphoprotein 32 family member A
• Gene Name: Anp32a
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 261
• Subcellular Localization: Nucleus. Cytoplasm. Shuttles between nucleus and cytoplasm..
• Protein Description: Implicated in a number of cellular processes, including proliferation, differentiation, caspase-dependent and caspase-independent apoptosis, suppression of transformation (tumor suppressor), inhibition of protein phosphatase 2A, regulation of mRNA trafficking and stability, and inhibition of acetyltransferases as part of the INHAT (inhibitor of histone acetyltransferases) complex..
• Protein Sequence: MEKRIELERRARKVNQITELNLDNCRSTSIVGLTDEYTALESLSLINVGLTTLKGFPKLPNLKKLELSDNRISSGLNYLTTSPKLQYLNLSGNKIKDLETLKPLEEFKNLVVLDLFNNDATQVDNYREKIFKMLPSLNFLDGFDCNDEEVQSDGDDDDEVNGNDSDEVGVSDEDDDSDDSDEEANGEVSLSEVYNDDLEEDNSDWEGEDEAGEEDEEEDSDIDDADGDANESAASVNAKDKDGEKEADESQVRGKKRKHDG

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
102	Acetylation	IKDLETLKPLEEFKN CCCHHHCCCHHHHHC	55.78	21791702
152	Phosphorylation	CNDEEVQSDGDDDDE CCCHHHCCCCCCCCC	49.05	19060867
152 (in isoform 2)	Phosphorylation	-	49.05	21082442
165 (in isoform 2)	Phosphorylation	-	39.40	21082442
250	Phosphorylation	GEKEADESQVRGKKR CCCCCCHHHHCCCCC	34.23	21082442

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of AN32A_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of AN32A_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of AN32A_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
AGT2L_DROME	CG8745	physical	22036573
TPIS_DROME	Tpi	physical	22036573
RUVB1_DROME	pont	physical	22036573

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.