PTH2_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: PTH2_DROME
• UniProt AC: O97067
• Protein Name: Probable peptidyl-tRNA hydrolase 2
• Gene Name: CG1307
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 186
• Protein Description: The natural substrate for this enzyme may be peptidyl-tRNAs which drop off the ribosome during protein synthesis..
• Protein Sequence: MGDKLLDPTQIINGLAVMLSFFVGYRYALKRGDAKDSVTEGAATPFSQESSVSSGSEASVSDKGYGGLNDNFKMVLVVRNDLKMGKGKIAAQCGHGAVGAYQRAVVRTPRLLRSWENCGCAKIAVRVESEAELMAIKKEAERQQLNTCLIRDAGRTQIEANSKTVLAVGPAAAADIDRVTGHLKLL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
53	Phosphorylation	FSQESSVSSGSEASV CCCCCCCCCCCCCCC	30.81	27794539

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of PTH2_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of PTH2_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of PTH2_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
RLA2_DROME	RpLP2	physical	14605208
CAND_DROME	sol	physical	14605208
MLC2_DROME	Mlc-c	physical	14605208
ARMC6_DROME	CG5721	physical	14605208

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.