dbPTM

MLC2_DROME - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	MLC2_DROME
UniProt AC	P54357
Protein Name	Myosin-2 essential light chain
Gene Name	Mlc-c
Organism	Drosophila melanogaster (Fruit fly).
Sequence Length	147
Subcellular Localization
Protein Description
Protein Sequence	MAAYTEDQLAEFQEAFNLFDNRGDGKIQLSQVGECLRALGQNPTESDVKKCTHQLKPDERISFEVFLPIYQAISKARSGDTADDFIEGLRHFDKDASGYISSAELRHLLTTLGEKLTDEEVEQLLANMEDQQGNINYEEFVRMVMSG

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
30	Phosphorylation	GDGKIQLSQVGECLR CCCCEEHHHHHHHHH	13.37	25749252
78	Phosphorylation	QAISKARSGDTADDF HHHHHHHCCCCHHHH	45.97	29892262
81	Phosphorylation	SKARSGDTADDFIEG HHHHCCCCHHHHHHH	35.20	29892262
97	Phosphorylation	RHFDKDASGYISSAE HHCCCCCCCCCCHHH	42.11	19429919
99	Phosphorylation	FDKDASGYISSAELR CCCCCCCCCCHHHHH	8.64	19429919
101	Phosphorylation	KDASGYISSAELRHL CCCCCCCCHHHHHHH	18.27	19429919

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of MLC2_DROME !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of MLC2_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of MLC2_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
MYSN_DROME	zip	physical	22036573
MYO7A_DROME	ck	physical	16917818
MYSN_DROME	zip	physical	16917818
MYS9_DROME	jar	physical	16917818
ASP_DROME	asp	physical	16917818

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of MLC2_DROME

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"An integrated chemical, mass spectrometric and computational strategyfor (quantitative) phosphoproteomics: application to Drosophilamelanogaster Kc167 cells."; Bodenmiller B., Mueller L.N., Pedrioli P.G.A., Pflieger D.,Juenger M.A., Eng J.K., Aebersold R., Tao W.A.; Mol. Biosyst. 3:275-286(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-30, AND MASSSPECTROMETRY.	17372656 [Abstract]