UniProt ID | MLC2_DROME | |
---|---|---|
UniProt AC | P54357 | |
Protein Name | Myosin-2 essential light chain | |
Gene Name | Mlc-c | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 147 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MAAYTEDQLAEFQEAFNLFDNRGDGKIQLSQVGECLRALGQNPTESDVKKCTHQLKPDERISFEVFLPIYQAISKARSGDTADDFIEGLRHFDKDASGYISSAELRHLLTTLGEKLTDEEVEQLLANMEDQQGNINYEEFVRMVMSG | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
30 | Phosphorylation | GDGKIQLSQVGECLR CCCCEEHHHHHHHHH | 13.37 | 25749252 | |
78 | Phosphorylation | QAISKARSGDTADDF HHHHHHHCCCCHHHH | 45.97 | 29892262 | |
81 | Phosphorylation | SKARSGDTADDFIEG HHHHCCCCHHHHHHH | 35.20 | 29892262 | |
97 | Phosphorylation | RHFDKDASGYISSAE HHCCCCCCCCCCHHH | 42.11 | 19429919 | |
99 | Phosphorylation | FDKDASGYISSAELR CCCCCCCCCCHHHHH | 8.64 | 19429919 | |
101 | Phosphorylation | KDASGYISSAELRHL CCCCCCCCHHHHHHH | 18.27 | 19429919 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MLC2_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MLC2_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MLC2_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
MYSN_DROME | zip | physical | 22036573 | |
MYO7A_DROME | ck | physical | 16917818 | |
MYSN_DROME | zip | physical | 16917818 | |
MYS9_DROME | jar | physical | 16917818 | |
ASP_DROME | asp | physical | 16917818 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"An integrated chemical, mass spectrometric and computational strategyfor (quantitative) phosphoproteomics: application to Drosophilamelanogaster Kc167 cells."; Bodenmiller B., Mueller L.N., Pedrioli P.G.A., Pflieger D.,Juenger M.A., Eng J.K., Aebersold R., Tao W.A.; Mol. Biosyst. 3:275-286(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-30, AND MASSSPECTROMETRY. |