UniProt ID | RLA2_DROME | |
---|---|---|
UniProt AC | P05389 | |
Protein Name | 60S acidic ribosomal protein P2 | |
Gene Name | RpLP2 | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 113 | |
Subcellular Localization | ||
Protein Description | Plays an important role in the elongation step of protein synthesis.. | |
Protein Sequence | MRYVAAYLLAVLGGKDSPANSDLEKILSSVGVEVDAERLTKVIKELAGKSIDDLIKEGREKLSSMPVGGGGAVAAADAAPAAAAGGDKKEAKKEEKKEESESEDDDMGFALFE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
41 | Acetylation | VDAERLTKVIKELAG CCHHHHHHHHHHHCC | 46.70 | 21791702 | |
44 | Acetylation | ERLTKVIKELAGKSI HHHHHHHHHHCCCCH | 50.06 | 21791702 | |
49 | Acetylation | VIKELAGKSIDDLIK HHHHHCCCCHHHHHH | 38.33 | 21791702 | |
50 | Phosphorylation | IKELAGKSIDDLIKE HHHHCCCCHHHHHHH | 30.27 | 27626673 | |
100 | Phosphorylation | KEEKKEESESEDDDM HHHHHHHCCCCCCCC | 47.73 | 21082442 | |
102 | Phosphorylation | EKKEESESEDDDMGF HHHHHCCCCCCCCCC | 56.45 | 21082442 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RLA2_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RLA2_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RLA2_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
ACOX1_DROME | CG5009 | physical | 14605208 | |
DORS_DROME | dl | physical | 14605208 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Phosphoproteome analysis of Drosophila melanogaster embryos."; Zhai B., Villen J., Beausoleil S.A., Mintseris J., Gygi S.P.; J. Proteome Res. 7:1675-1682(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-100 AND SER-102, ANDMASS SPECTROMETRY. |