| UniProt ID | PRAP1_HUMAN | |
|---|---|---|
| UniProt AC | Q96NZ9 | |
| Protein Name | Proline-rich acidic protein 1 | |
| Gene Name | PRAP1 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 151 | |
| Subcellular Localization | Secreted . | |
| Protein Description | May play an important role in maintaining normal growth homeostasis in epithelial cells.. | |
| Protein Sequence | MRRLLLVTSLVVVLLWEAGAVPAPKVPIKMQVKHWPSEQDPEKAWGARVVEPPEKDDQLVVLFPVQKPKLLTTEEKPRGQGRGPILPGTKAWMETEDTLGHVLSPEPDHDSLYHPPPEEDQGEERPRLWVMPNHQVLLGPEEDQDHIYHPQ | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 37 | Phosphorylation | MQVKHWPSEQDPEKA EEECCCCCCCCHHHH | 42.57 | 29083192 | |
| 72 | O-linked_Glycosylation | VQKPKLLTTEEKPRG ECCCEEECCCCCCCC | 42.47 | 55827727 | |
| 73 | O-linked_Glycosylation | QKPKLLTTEEKPRGQ CCCEEECCCCCCCCC | 41.96 | 55827731 | |
| 89 | O-linked_Glycosylation | RGPILPGTKAWMETE CCCCCCCCCEEECCC | 18.69 | 55825633 | |
| 104 | O-linked_Glycosylation | DTLGHVLSPEPDHDS CCCCCCCCCCCCCCC | 26.57 | 55828767 | |
| 111 | O-linked_Glycosylation | SPEPDHDSLYHPPPE CCCCCCCCCCCCCCH | 27.66 | 55828773 | |
| 113 | O-linked_Glycosylation | EPDHDSLYHPPPEED CCCCCCCCCCCCHHH | 19.07 | 55828779 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PRAP1_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PRAP1_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PRAP1_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| LACRT_HUMAN | LACRT | physical | 26186194 | |
| CD48_HUMAN | CD48 | physical | 26186194 | |
| UBQL1_HUMAN | UBQLN1 | physical | 21516116 | |
| CD48_HUMAN | CD48 | physical | 28514442 | |
| LACRT_HUMAN | LACRT | physical | 28514442 | |
| TRFL_HUMAN | LTF | physical | 28514442 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
