UniProt ID | CD48_HUMAN | |
---|---|---|
UniProt AC | P09326 | |
Protein Name | CD48 antigen | |
Gene Name | CD48 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 243 | |
Subcellular Localization |
Cell membrane Lipid-anchor, GPI-anchor . |
|
Protein Description | Ligand for CD2. Might facilitate interaction between activated lymphocytes. Probably involved in regulating T-cell activation.. | |
Protein Sequence | MCSRGWDSCLALELLLLPLSLLVTSIQGHLVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESVNYTWYGDKRPFPKELQNSVLETTLMPHNYSRCYTCQVSNSVSSKNGTVCLSPPCTLARSFGVEWIASWLVVTVPTILGLLLT | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
40 | N-linked_Glycosylation | MTVVSGSNVTLNISE EEEECCCEEEEECCC | 34.03 | UniProtKB CARBOHYD | |
44 | N-linked_Glycosylation | SGSNVTLNISESLPE CCCEEEEECCCCCCC | 26.78 | UniProtKB CARBOHYD | |
57 | Phosphorylation | PENYKQLTWFYTFDQ CCHHCEEEEEEECCC | 15.84 | 25219547 | |
60 | Phosphorylation | YKQLTWFYTFDQKIV HCEEEEEEECCCEEE | 9.69 | 25219547 | |
61 | Phosphorylation | KQLTWFYTFDQKIVE CEEEEEEECCCEEEE | 15.97 | 25219547 | |
76 | Phosphorylation | WDSRKSKYFESKFKG EHHHCCHHCHHHCCC | 21.48 | - | |
104 | N-linked_Glycosylation | SKVQKEDNSTYIMRV EEEEECCCCEEEEEE | 37.02 | 19349973 | |
124 | Ubiquitination | NEQEWKIKLQVLDPV CCEEEEEEEEECCCC | 29.19 | - | |
131 (in isoform 2) | Phosphorylation | - | 10.71 | 22210691 | |
149 | Phosphorylation | EDMDDNCYLKLSCVI EECCCCEEEEEEEEE | 17.08 | 29759185 | |
162 | N-linked_Glycosylation | VIPGESVNYTWYGDK EECCCCEECEEECCC | 37.48 | UniProtKB CARBOHYD | |
178 | N-linked_Glycosylation | PFPKELQNSVLETTL CCCHHHHCCHHHHCC | 46.86 | 19349973 | |
189 | N-linked_Glycosylation | ETTLMPHNYSRCYTC HHCCCCCCCCCCEEE | 30.51 | 19349973 | |
220 | GPI-anchor | PPCTLARSFGVEWIA CCCHHCHHHCHHHHH | 22.27 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CD48_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CD48_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CD48_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
N-linked Glycosylation | |
Reference | PubMed |
"Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins."; Wollscheid B., Bausch-Fluck D., Henderson C., O'Brien R., Bibel M.,Schiess R., Aebersold R., Watts J.D.; Nat. Biotechnol. 27:378-386(2009). Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-104; ASN-178 AND ASN-189,AND MASS SPECTROMETRY. |