UniProt ID | PPIC_HUMAN | |
---|---|---|
UniProt AC | P45877 | |
Protein Name | Peptidyl-prolyl cis-trans isomerase C {ECO:0000305} | |
Gene Name | PPIC {ECO:0000312|HGNC:HGNC:9256} | |
Organism | Homo sapiens (Human). | |
Sequence Length | 212 | |
Subcellular Localization | Cytoplasm . | |
Protein Description | PPIase that catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and may therefore assist protein folding.. | |
Protein Sequence | MGPGPRLLLPLVLCVGLGALVFSSGAEGFRKRGPSVTAKVFFDVRIGDKDVGRIVIGLFGKVVPKTVENFVALATGEKGYGYKGSKFHRVIKDFMIQGGDITTGDGTGGVSIYGETFPDENFKLKHYGIGWVSMANAGPDTNGSQFFITLTKPTWLDGKHVVFGKVIDGMTVVHSIELQATDGHDRPLTNCSIINSGKIDVKTPFVVEIADW | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
35 | Phosphorylation | GFRKRGPSVTAKVFF CHHHCCCCEEEEEEE | 34.62 | 20068231 | |
37 | Phosphorylation | RKRGPSVTAKVFFDV HHCCCCEEEEEEEEE | 25.71 | 20068231 | |
45 | Methylation | AKVFFDVRIGDKDVG EEEEEEEEECCCCHH | 29.08 | 115488317 | |
65 | Ubiquitination | LFGKVVPKTVENFVA ECCCCCCHHHHHHHH | 54.30 | 29967540 | |
78 | Ubiquitination | VALATGEKGYGYKGS HHHHCCCCCCCCCCC | 59.79 | 29967540 | |
86 | Ubiquitination | GYGYKGSKFHRVIKD CCCCCCCHHHHEEEC | 54.58 | 23000965 | |
92 | Ubiquitination | SKFHRVIKDFMIQGG CHHHHEEECCEEECC | 41.90 | 23000965 | |
102 | Phosphorylation | MIQGGDITTGDGTGG EEECCCCCCCCCCCC | 29.48 | 23532336 | |
103 | Phosphorylation | IQGGDITTGDGTGGV EECCCCCCCCCCCCE | 33.34 | 23532336 | |
123 | Methylation | TFPDENFKLKHYGIG CCCCCCCEECEEEEE | 69.11 | - | |
123 | Ubiquitination | TFPDENFKLKHYGIG CCCCCCCEECEEEEE | 69.11 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PPIC_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PPIC_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PPIC_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TMED4_HUMAN | TMED4 | physical | 22939629 | |
SGTA_HUMAN | SGTA | physical | 25416956 | |
UBQL1_HUMAN | UBQLN1 | physical | 25416956 | |
UBAP1_HUMAN | UBAP1 | physical | 25416956 | |
BANP_HUMAN | BANP | physical | 25416956 |
Kegg Disease | |
---|---|
There are no disease associations of PTM sites. | |
OMIM Disease | |
There are no disease associations of PTM sites. | |
Kegg Drug | |
There are no disease associations of PTM sites. | |
DrugBank | |
DB00172 | L-Proline |
loading...