UniProt ID | PP2B1_DROME | |
---|---|---|
UniProt AC | P48456 | |
Protein Name | Serine/threonine-protein phosphatase 2B catalytic subunit 1 | |
Gene Name | CanA1 | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 622 | |
Subcellular Localization | ||
Protein Description | Calcium-dependent, calmodulin-stimulated protein phosphatase. This subunit may have a role in the calmodulin activation of calcineurin.. | |
Protein Sequence | MSATSTRSSVTRKSSLSKSSSSDKSAKSSSNSSKSPTAASGNKQKMQYTKTRERMVDDVPLPPTHKLTMSEVYDDPKTGKPNFDALRQHFLLEGRIEEAVALRIITEGAALLREEKNMIDVEAPITVCGDIHGQFFDLVKLFEVGGPPATTRYLFLGDYVDRGYFSIECVLYLWSLKITYPTTLSLLRGNHECRHLTEYFTFKQECIIKYSESIYDACMEAFDCLPLAALLNQQFLCIHGGLSPEIFTLDDIKTLNRFREPPAYGPMCDLLWSDPLEDFGNEKTNEFFSHNSVRGCSYFFSYSACCEFLQKNNLLSIVRAHEAQDAGYRMYRKNQVTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNILNICSDDELVAGPDDELEEELRKKIVLVPANASNNNNNNNTPSKPASMSALRKEIIRNKIRAIGKMSRVFSILREESESVLQLKGLTPTGALPVGALSGGRDSLKEALQGLTASSHIHSFAEAKGLDAVNERMPPRRPLLMSASSSSITTVTRSSSSSSNNNNNNSNTSSTTTTKDISNTSSNDTATVTKTSRTTVKSATTSNVRAGFTAKKFP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MSATSTRSS ------CCCCCCCCC | 40.01 | 19429919 | |
4 | Phosphorylation | ----MSATSTRSSVT ----CCCCCCCCCCC | 24.27 | 19429919 | |
5 | Phosphorylation | ---MSATSTRSSVTR ---CCCCCCCCCCCC | 22.88 | 19429919 | |
6 | Phosphorylation | --MSATSTRSSVTRK --CCCCCCCCCCCCH | 30.16 | 19429919 | |
8 | Phosphorylation | MSATSTRSSVTRKSS CCCCCCCCCCCCHHH | 29.28 | 19429919 | |
9 | Phosphorylation | SATSTRSSVTRKSSL CCCCCCCCCCCHHHC | 24.98 | 19429919 | |
64 | Phosphorylation | DDVPLPPTHKLTMSE CCCCCCCCCCCCHHH | 29.69 | 22817900 | |
495 | Phosphorylation | VLQLKGLTPTGALPV HHHCCCCCCCCCCCH | 27.72 | 22817900 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PP2B1_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PP2B1_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PP2B1_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
E631_DROME | Eip63F-1 | physical | 14605208 | |
CANB1_DROME | CanB | physical | 14605208 | |
CALL_DROME | Acam | physical | 14605208 | |
SCN60_DROME | NaCP60E | physical | 14605208 | |
PP2B2_DROME | Pp2B-14D | physical | 22036573 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...