PP2B1_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: PP2B1_DROME
• UniProt AC: P48456
• Protein Name: Serine/threonine-protein phosphatase 2B catalytic subunit 1
• Gene Name: CanA1
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 622
• Protein Description: Calcium-dependent, calmodulin-stimulated protein phosphatase. This subunit may have a role in the calmodulin activation of calcineurin..
• Protein Sequence: MSATSTRSSVTRKSSLSKSSSSDKSAKSSSNSSKSPTAASGNKQKMQYTKTRERMVDDVPLPPTHKLTMSEVYDDPKTGKPNFDALRQHFLLEGRIEEAVALRIITEGAALLREEKNMIDVEAPITVCGDIHGQFFDLVKLFEVGGPPATTRYLFLGDYVDRGYFSIECVLYLWSLKITYPTTLSLLRGNHECRHLTEYFTFKQECIIKYSESIYDACMEAFDCLPLAALLNQQFLCIHGGLSPEIFTLDDIKTLNRFREPPAYGPMCDLLWSDPLEDFGNEKTNEFFSHNSVRGCSYFFSYSACCEFLQKNNLLSIVRAHEAQDAGYRMYRKNQVTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNILNICSDDELVAGPDDELEEELRKKIVLVPANASNNNNNNNTPSKPASMSALRKEIIRNKIRAIGKMSRVFSILREESESVLQLKGLTPTGALPVGALSGGRDSLKEALQGLTASSHIHSFAEAKGLDAVNERMPPRRPLLMSASSSSITTVTRSSSSSSNNNNNNSNTSSTTTTKDISNTSSNDTATVTKTSRTTVKSATTSNVRAGFTAKKFP

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MSATSTRSS ------CCCCCCCCC	40.01	19429919
4	Phosphorylation	----MSATSTRSSVT ----CCCCCCCCCCC	24.27	19429919
5	Phosphorylation	---MSATSTRSSVTR ---CCCCCCCCCCCC	22.88	19429919
6	Phosphorylation	--MSATSTRSSVTRK --CCCCCCCCCCCCH	30.16	19429919
8	Phosphorylation	MSATSTRSSVTRKSS CCCCCCCCCCCCHHH	29.28	19429919
9	Phosphorylation	SATSTRSSVTRKSSL CCCCCCCCCCCHHHC	24.98	19429919
64	Phosphorylation	DDVPLPPTHKLTMSE CCCCCCCCCCCCHHH	29.69	22817900
495	Phosphorylation	VLQLKGLTPTGALPV HHHCCCCCCCCCCCH	27.72	22817900

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of PP2B1_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of PP2B1_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of PP2B1_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
E631_DROME	Eip63F-1	physical	14605208
CANB1_DROME	CanB	physical	14605208
CALL_DROME	Acam	physical	14605208
SCN60_DROME	NaCP60E	physical	14605208
PP2B2_DROME	Pp2B-14D	physical	22036573

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.