CALL_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CALL_DROME
• UniProt AC: P49258
• Protein Name: Calmodulin-related protein 97A
• Gene Name: Acam
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 148
• Protein Description: May be involved in calcium-mediated signal transduction..
• Protein Sequence: MSELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQDLIAEAENNNNGQLNFTEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFISPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of CALL_DROME !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CALL_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CALL_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CALL_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TNNI_DROME	wupA	physical	14605208
KCC2A_DROME	CaMKII	physical	14605208
AST5_DROME	ac	physical	14605208
INX2_DROME	Inx2	physical	14605208
MYS9_DROME	jar	physical	22851764
MYS9_DROME	jar	physical	16790438

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.