INX2_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: INX2_DROME
• UniProt AC: Q9V427
• Protein Name: Innexin inx2
• Gene Name: Inx2
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 367
• Subcellular Localization: Cell membrane ; Multi-pass membrane protein . Cell junction, gap junction. Cytoplasm. Apical cell membrane. Apicolateral cell membrane. Basolateral cell membrane. Lateral cell membrane. In ovary, localizes to the apicolateral membrane between follicl
• Protein Description: Structural components of the gap junctions. Involved in gap junctional communication between germline and somatic cells which is essential for normal oogenesis. In embryonic epidermis, required for epithelial morphogenesis. Required for keyhole formation during early stages of proventriculus development in response to wg signaling. In follicle cells, promotes the formation of egg chambers in part through regulation of shg and baz at the boundary between germ cells and follicle cells. In inner germarial sheath cells, required for survival of early germ cells and for cyst formation..
• Protein Sequence: MFDVFGSVKGLLKIDQVCIDNNVFRMHYKATVIILIAFSLLVTSRQYIGDPIDCIVDEIPLGVMDTYCWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWKSWEGGRLKMLVMDLNSPIVNDECKNDRKKILVDYFIGNLNRHNFYAFRFFVCEALNFVNVIGQIYFVDFFLDGEFSTYGSDVLKFTELEPDERIDPMARVFPKVTKCTFHKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFWFIILSIMSGISLIYRIAVVAGPKLRHLLLRARSRLAESEEVELVANKCNIGDWFLLYQLGKNIDPLIYKEVISDLSREMSGDEHSAHKRPFDA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
359	Phosphorylation	EMSGDEHSAHKRPFD HHCCCCCCCCCCCCC	29.98	27794539

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of INX2_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of INX2_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of INX2_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CADE_DROME	shg	genetic	22001874
INX3_DROME	Inx3	genetic	10888681

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.