PNO1_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: PNO1_DROME
• UniProt AC: Q9VR89
• Protein Name: RNA-binding protein pno1
• Gene Name: l(1)G0004
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 240
• Subcellular Localization: Nucleus, nucleolus.
• Protein Sequence: MEAENIRADAFEPAKRATKRGASGGGQQDVEMQVDEATGIEGQVLGSSRASAPPKAKRARSELRKVSVPPHRYSSLKEHWMKIFTPVVEHMKLQIRFNMKARQVELRVGPETPDIANLQRGADFVRAFLCGFEVDDALALLRLEDLFVESFEIKDVKTLRGDHQSRAIGRLAGKGGRTKFTIENVTKTRIVLADSKIHILGSYQNIQLARRAVCNLILGSPPSKVYGNLRAVASRLSERM

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
220	Phosphorylation	VCNLILGSPPSKVYG HHHHHHCCCCHHHHH	30.14	21082442

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of PNO1_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of PNO1_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of PNO1_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PP2B1_DROME	CanA1	physical	14605208
CPSF6_DROME	CG7185	physical	14605208
PP2B2_DROME	Pp2B-14D	physical	14605208

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.