UniProt ID | PNO1_DROME | |
---|---|---|
UniProt AC | Q9VR89 | |
Protein Name | RNA-binding protein pno1 | |
Gene Name | l(1)G0004 | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 240 | |
Subcellular Localization | Nucleus, nucleolus. | |
Protein Description | ||
Protein Sequence | MEAENIRADAFEPAKRATKRGASGGGQQDVEMQVDEATGIEGQVLGSSRASAPPKAKRARSELRKVSVPPHRYSSLKEHWMKIFTPVVEHMKLQIRFNMKARQVELRVGPETPDIANLQRGADFVRAFLCGFEVDDALALLRLEDLFVESFEIKDVKTLRGDHQSRAIGRLAGKGGRTKFTIENVTKTRIVLADSKIHILGSYQNIQLARRAVCNLILGSPPSKVYGNLRAVASRLSERM | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
220 | Phosphorylation | VCNLILGSPPSKVYG HHHHHHCCCCHHHHH | 30.14 | 21082442 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PNO1_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PNO1_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PNO1_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
PP2B1_DROME | CanA1 | physical | 14605208 | |
CPSF6_DROME | CG7185 | physical | 14605208 | |
PP2B2_DROME | Pp2B-14D | physical | 14605208 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...