UniProt ID | PLPP3_HUMAN | |
---|---|---|
UniProt AC | O14495 | |
Protein Name | Phospholipid phosphatase 3 {ECO:0000312|HGNC:HGNC:9229} | |
Gene Name | PLPP3 {ECO:0000312|HGNC:HGNC:9229} | |
Organism | Homo sapiens (Human). | |
Sequence Length | 311 | |
Subcellular Localization |
Golgi apparatus, trans-Golgi network membrane Multi-pass membrane protein. Cell membrane Multi-pass membrane protein. |
|
Protein Description | Catalyzes the conversion of phosphatidic acid (PA) to diacylglycerol (DG). In addition it hydrolyzes lysophosphatidic acid (LPA), ceramide-1-phosphate (C-1-P) and sphingosine-1-phosphate (S-1-P). The relative catalytic efficiency is LPA = PA > C-1-P > S-1-P. May be involved in cell adhesion and in cell-cell interactions.. | |
Protein Sequence | MQNYKYDKAIVPESKNGGSPALNNNPRRSGSKRVLLICLDLFCLFMAGLPFLIIETSTIKPYHRGFYCNDESIKYPLKTGETINDAVLCAVGIVIAILAIITGEFYRIYYLKKSRSTIQNPYVAALYKQVGCFLFGCAISQSFTDIAKVSIGRLRPHFLSVCNPDFSQINCSEGYIQNYRCRGDDSKVQEARKSFFSGHASFSMYTMLYLVLYLQARFTWRGARLLRPLLQFTLIMMAFYTGLSRVSDHKHHPSDVLAGFAQGALVACCIVFFVSDLFKTKTTLSLPAPAIRKEILSPVDIIDRNNHHNMM | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
5 | Ubiquitination | ---MQNYKYDKAIVP ---CCCCCCCCCCCC | 33845483 | ||
8 | Ubiquitination | MQNYKYDKAIVPESK CCCCCCCCCCCCCCC | 33845483 | ||
15 | Ubiquitination | KAIVPESKNGGSPAL CCCCCCCCCCCCCCC | 21906983 | ||
19 | Phosphorylation | PESKNGGSPALNNNP CCCCCCCCCCCCCCC | 30266825 | ||
110 | Phosphorylation | GEFYRIYYLKKSRST CCHHHEEEECCCCCC | 17924679 | ||
170 | N-linked_Glycosylation | NPDFSQINCSEGYIQ CCCHHHCCCCCCCCC | UniProtKB CARBOHYD | ||
282 | Phosphorylation | SDLFKTKTTLSLPAP HHHHCCCCCCCCCCH | 29083192 | ||
283 | Phosphorylation | DLFKTKTTLSLPAPA HHHCCCCCCCCCCHH | 29083192 | ||
285 | Phosphorylation | FKTKTTLSLPAPAIR HCCCCCCCCCCHHHH | 29083192 | ||
293 | Ubiquitination | LPAPAIRKEILSPVD CCCHHHHHHHCCCCC | 21906983 | ||
297 | Phosphorylation | AIRKEILSPVDIIDR HHHHHHCCCCCEECC | 19664994 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PLPP3_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PLPP3_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PLPP3_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
A4_HUMAN | APP | physical | 21832049 | |
PLPP3_HUMAN | PPAP2B | physical | 14725715 | |
CTND1_HUMAN | CTNND1 | physical | 20123964 | |
PLPP3_HUMAN | PPAP2B | physical | 18215144 | |
PLPP2_HUMAN | PPAP2C | physical | 18215144 | |
PLPP1_HUMAN | PPAP2A | physical | 18215144 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...