| UniProt ID | PEX2_HUMAN | |
|---|---|---|
| UniProt AC | P28328 | |
| Protein Name | Peroxisome biogenesis factor 2 | |
| Gene Name | PEX2 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 305 | |
| Subcellular Localization |
Peroxisome membrane Multi-pass membrane protein. |
|
| Protein Description | Somewhat implicated in the biogenesis of peroxisomes.. | |
| Protein Sequence | MASRKENAKSANRVLRISQLDALELNKALEQLVWSQFTQCFHGFKPGLLARFEPEVKACLWVFLWRFTIYSKNATVGQSVLNIKYKNDFSPNLRYQPPSKNQKIWYAVCTIGGRWLEERCYDLFRNHHLASFGKVKQCVNFVIGLLKLGGLINFLIFLQRGKFATLTERLLGIHSVFCKPQNICEVGFEYMNRELLWHGFAEFLIFLLPLINVQKLKAKLSSWCIPLTGAPNSDNTLATSGKECALCGEWPTMPHTIGCEHIFCYFCAKSSFLFDVYFTCPKCGTEVHSLQPLKSGIEMSEVNAL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 79 | Phosphorylation | KNATVGQSVLNIKYK CCCCCCEEEEEEEEC | 23.73 | 29978859 | |
| 84 | Methylation | GQSVLNIKYKNDFSP CEEEEEEEECCCCCC | 49.45 | 22650925 | |
| 84 | Acetylation | GQSVLNIKYKNDFSP CEEEEEEEECCCCCC | 49.45 | 19608861 | |
| 84 | Malonylation | GQSVLNIKYKNDFSP CEEEEEEEECCCCCC | 49.45 | 26320211 | |
| 86 | Ubiquitination | SVLNIKYKNDFSPNL EEEEEEECCCCCCCC | 45.07 | 27667366 | |
| 86 | Malonylation | SVLNIKYKNDFSPNL EEEEEEECCCCCCCC | 45.07 | 26320211 | |
| 100 | Ubiquitination | LRYQPPSKNQKIWYA CCCCCCCCCCCEEEE | 69.99 | 27667366 | |
| 162 | Ubiquitination | LIFLQRGKFATLTER HHHHHCCCHHHHHHH | 33.73 | 27667366 | |
| 219 | Ubiquitination | NVQKLKAKLSSWCIP CHHHHHHHHHHCCEE | 47.52 | - | |
| 221 | Phosphorylation | QKLKAKLSSWCIPLT HHHHHHHHHCCEECC | 22.53 | 22210691 | |
| 222 | Phosphorylation | KLKAKLSSWCIPLTG HHHHHHHHCCEECCC | 36.08 | 22210691 | |
| 228 | Phosphorylation | SSWCIPLTGAPNSDN HHCCEECCCCCCCCC | 26.41 | 22210691 | |
| 295 | Phosphorylation | HSLQPLKSGIEMSEV CCCCCCCCCCCHHHH | 53.32 | - | |
| 300 | Phosphorylation | LKSGIEMSEVNAL-- CCCCCCHHHHCCC-- | 26.13 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PEX2_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PEX2_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PEX2_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| ERG28_HUMAN | C14orf1 | physical | 16169070 | |
| TLE1_HUMAN | TLE1 | physical | 16169070 | |
| PEX10_HUMAN | PEX10 | physical | 10837480 | |
| A4_HUMAN | APP | physical | 21832049 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| H00205 | Zellweger syndrome spectrum, including: Zellweger syndrome (ZS); Adrenoleukodystrophy, neonatal (NAL | |||||
| OMIM Disease | ||||||
| 614866 | Peroxisome biogenesis disorder complementation group 5 (PBD-CG5) | |||||
| 614866 | Peroxisome biogenesis disorder 5A (PBD5A) | |||||
| 614867 | Peroxisome biogenesis disorder 5B (PBD5B) | |||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Acetylation | |
| Reference | PubMed |
| "Lysine acetylation targets protein complexes and co-regulates majorcellular functions."; Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.,Olsen J.V., Mann M.; Science 325:834-840(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-84, AND MASS SPECTROMETRY. | |
