PDV1_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: PDV1_ARATH
• UniProt AC: Q9FK13
• Protein Name: Plastid division protein PDV1
• Gene Name: PDV1
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 272
• Subcellular Localization: Plastid, chloroplast outer membrane ; Single-pass membrane protein . Plastid equatorial positioning in a discontinuous ring mediated by CDP1.
• Protein Description: Component of the plastid division machinery. Required to mediate the recruitment of ARC5 at the midplastid constriction site in the cytoplasm..
• Protein Sequence: MGEMEIEEIEAVLEKIWDLHDKLSDEIHLISKSHFLKSVKPSNRSEKRKNPHGNSGEDKRPGYVFIKGFAVDDNDSTIQEAKSLNAIRTALENLEDQLEFFHTIHTQQRTEKDVAIARLEQSRILLAMRLAEHHGKNYGVLEEALAFVGSIKSNSHYVSPDHLYDSSRNPDGANSIPDGIESNFVINAFASTFGFAKRALGFNHVKGVLGNAAIFAISVVAMLHLHQVATSEHHLQKKEDRFYRSQQRKTYGRDKSSADRSLDHLDVMMARG

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
159	Phosphorylation	KSNSHYVSPDHLYDS HCCCCCCCHHHHCCC	19.90	29654922

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of PDV1_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of PDV1_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of PDV1_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PDV1_ARATH	PDV1	physical	23595201
PDV2_ARATH	PDV2	physical	23595201
ARC5_ARATH	ARC5	physical	23595201

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.