UniProt ID | PDV1_ARATH | |
---|---|---|
UniProt AC | Q9FK13 | |
Protein Name | Plastid division protein PDV1 | |
Gene Name | PDV1 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 272 | |
Subcellular Localization |
Plastid, chloroplast outer membrane Single-pass membrane protein . Plastid equatorial positioning in a discontinuous ring mediated by CDP1. |
|
Protein Description | Component of the plastid division machinery. Required to mediate the recruitment of ARC5 at the midplastid constriction site in the cytoplasm.. | |
Protein Sequence | MGEMEIEEIEAVLEKIWDLHDKLSDEIHLISKSHFLKSVKPSNRSEKRKNPHGNSGEDKRPGYVFIKGFAVDDNDSTIQEAKSLNAIRTALENLEDQLEFFHTIHTQQRTEKDVAIARLEQSRILLAMRLAEHHGKNYGVLEEALAFVGSIKSNSHYVSPDHLYDSSRNPDGANSIPDGIESNFVINAFASTFGFAKRALGFNHVKGVLGNAAIFAISVVAMLHLHQVATSEHHLQKKEDRFYRSQQRKTYGRDKSSADRSLDHLDVMMARG | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
159 | Phosphorylation | KSNSHYVSPDHLYDS HCCCCCCCHHHHCCC | 19.90 | 29654922 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PDV1_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PDV1_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PDV1_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
PDV1_ARATH | PDV1 | physical | 23595201 | |
PDV2_ARATH | PDV2 | physical | 23595201 | |
ARC5_ARATH | ARC5 | physical | 23595201 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...