ODC_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ODC_HUMAN
• UniProt AC: Q9BQT8
• Protein Name: Mitochondrial 2-oxodicarboxylate carrier
• Gene Name: SLC25A21
• Organism: Homo sapiens (Human).
• Sequence Length: 299
• Subcellular Localization: Mitochondrion inner membrane; Multi-pass membrane protein.
• Protein Description: Transports C5-C7 oxodicarboxylates across the inner membranes of mitochondria. Can transport 2-oxoadipate, 2-oxoglutarate, adipate, glutarate, and to a lesser extent, pimelate, 2-oxopimelate, 2-aminoadipate, oxaloacetate, and citrate..
• Protein Sequence: MSAKPEVSLVREASRQIVAGGSAGLVEICLMHPLDVVKTRFQIQRCATDPNSYKSLVDSFRMIFQMEGLFGFYKGILPPILAETPKRAVKFFTFEQYKKLLGYVSLSPALTFAIAGLGSGLTEAIVVNPFEVVKVGLQANRNTFAEQPSTVGYARQIIKKEGWGLQGLNKGLTATLGRHGVFNMVYFGFYYNVKNMIPVNKDPILEFWRKFGIGLLSGTIASVINIPFDVAKSRIQGPQPVPGEIKYRTCFKTMATVYQEEGILALYKGLLPKIMRLGPGGAVMLLVYEYTYSWLQENW

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
55	Phosphorylation	TDPNSYKSLVDSFRM CCCCHHHHHHHHHHH	25.95	22210691
59	Phosphorylation	SYKSLVDSFRMIFQM HHHHHHHHHHHHHHH	13.79	22210691
84	Phosphorylation	LPPILAETPKRAVKF CCHHHHCCCCCEEEE	28.62	22210691
153	Phosphorylation	EQPSTVGYARQIIKK CCCCHHHHHHHHHHH	8.35	-
173	Phosphorylation	QGLNKGLTATLGRHG CCCCCCHHHHHCCCC	26.68	22210691
175	Phosphorylation	LNKGLTATLGRHGVF CCCCHHHHHCCCCCC	25.22	24719451
214	Ubiquitination	FWRKFGIGLLSGTIA HHHHHCCHHHCCCHH	22.42	27667366
216	Ubiquitination	RKFGIGLLSGTIASV HHHCCHHHCCCHHHH	3.60	27667366
246	Ubiquitination	QPVPGEIKYRTCFKT CCCCCCEEEEECEEH	25.11	27667366
250	Ubiquitination	GEIKYRTCFKTMATV CCEEEEECEEHHHHH	2.14	27667366

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ODC_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ODC_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ODC_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TBX20_HUMAN	TBX20	physical	26186194
NOSIP_HUMAN	NOSIP	physical	26186194
DNSL2_HUMAN	DNASE1L2	physical	26186194
PPIE_HUMAN	PPIE	physical	26186194
TBX20_HUMAN	TBX20	physical	28514442
DNSL2_HUMAN	DNASE1L2	physical	28514442
PPIE_HUMAN	PPIE	physical	28514442

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.