UniProt ID | OBF1_HUMAN | |
---|---|---|
UniProt AC | Q16633 | |
Protein Name | POU domain class 2-associating factor 1 | |
Gene Name | POU2AF1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 256 | |
Subcellular Localization | Nucleus. | |
Protein Description | Transcriptional coactivator that specifically associates with either OCT1 or OCT2. It boosts the OCT1 mediated promoter activity and to a lesser extent, that of OCT2. It has no intrinsic DNA-binding activity. It recognizes the POU domains of OCT1 and OCT2. It is essential for the response of B-cells to antigens and required for the formation of germinal centers.. | |
Protein Sequence | MLWQKPTAPEQAPAPARPYQGVRVKEPVKELLRRKRGHASSGAAPAPTAVVLPHQPLATYTTVGPSCLDMEGSVSAVTEEAALCAGWLSQPTPATLQPLAPWTPYTEYVPHEAVSCPYSADMYVQPVCPSYTVVGPSSVLTYASPPLITNVTTRSSATPAVGPPLEGPEHQAPLTYFPWPQPLSTLPTSTLQYQPPAPALPGPQFVQLPISIPEPVLQDMEDPRRAASSLTIDKLLLEEEDSDAYALNHTLSVEGF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
7 | Phosphorylation | -MLWQKPTAPEQAPA -CCCCCCCCCCCCCC | 62.98 | - | |
19 | Phosphorylation | APAPARPYQGVRVKE CCCCCCCCCCCCCCH | 16.61 | - | |
29 | Ubiquitination | VRVKEPVKELLRRKR CCCCHHHHHHHHHHC | 54.05 | - | |
40 | Phosphorylation | RRKRGHASSGAAPAP HHHCCCCCCCCCCCC | 24.51 | - | |
130 | O-linked_Glycosylation | YVQPVCPSYTVVGPS EEECCCCCCEEECCH | 28.45 | 29351928 | |
184 | Phosphorylation | FPWPQPLSTLPTSTL CCCCCCCCCCCCCCC | 34.28 | 9211847 | |
228 | Phosphorylation | EDPRRAASSLTIDKL CCHHHHHHHCCHHHH | 25.54 | 28348404 | |
242 | Phosphorylation | LLLEEEDSDAYALNH HHCCCCCCCCHHHCC | 27.67 | 28674151 | |
245 | Phosphorylation | EEEDSDAYALNHTLS CCCCCCCHHHCCCEE | 19.33 | 28674151 | |
252 | Phosphorylation | YALNHTLSVEGF--- HHHCCCEEECCC--- | 21.19 | 28348404 |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of OBF1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of OBF1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
PO2F1_HUMAN | POU2F1 | physical | 10541551 | |
PO2F1_HUMAN | POU2F1 | physical | 9418884 | |
PO2F1_HUMAN | POU2F1 | physical | 11380252 | |
SIAH1_HUMAN | SIAH1 | physical | 11483517 | |
SIAH1_HUMAN | SIAH1 | genetic | 11483517 | |
TCP4_HUMAN | SUB1 | physical | 9632764 | |
PAX8_HUMAN | PAX8 | physical | 20211142 | |
RHXF2_HUMAN | RHOXF2 | physical | 20211142 | |
GTF2I_HUMAN | GTF2I | physical | 21549311 | |
SIAH1_HUMAN | SIAH1 | physical | 11483518 | |
ATE1_HUMAN | ATE1 | physical | 26186194 | |
ATE1_HUMAN | ATE1 | physical | 28514442 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...