| UniProt ID | NPY_HUMAN | |
|---|---|---|
| UniProt AC | P01303 | |
| Protein Name | Pro-neuropeptide Y | |
| Gene Name | NPY | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 97 | |
| Subcellular Localization | Secreted. | |
| Protein Description | NPY is implicated in the control of feeding and in secretion of gonadotrophin-release hormone.. | |
| Protein Sequence | MLGNKRLGLSGLTLALSLLVCLGALAEAYPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRYGKRSSPETLISDLLMRESTENVPRTRLEDPAMW | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 31 | Phosphorylation | ALAEAYPSKPDNPGE HHHHHCCCCCCCCCC | 44.11 | 26657352 | |
| 48 | Phosphorylation | PAEDMARYYSALRHY CHHHHHHHHHHHHHH | 7.70 | - | |
| 49 | Phosphorylation | AEDMARYYSALRHYI HHHHHHHHHHHHHHH | 5.06 | - | |
| 50 | Phosphorylation | EDMARYYSALRHYIN HHHHHHHHHHHHHHH | 16.34 | 24275569 | |
| 55 | Phosphorylation | YYSALRHYINLITRQ HHHHHHHHHHHHHHH | 5.76 | - | |
| 64 | Tyrosine amide | NLITRQRYGKRSSPE HHHHHHHHCCCCCHH | 20.75 | - | |
| 64 | Amidation | NLITRQRYGKRSSPE HHHHHHHHCCCCCHH | 20.75 | 6589611 | |
| 68 | Phosphorylation | RQRYGKRSSPETLIS HHHHCCCCCHHHHHH | 54.45 | 29083192 | |
| 69 | Phosphorylation | QRYGKRSSPETLISD HHHCCCCCHHHHHHH | 30.68 | 29083192 | |
| 72 | Phosphorylation | GKRSSPETLISDLLM CCCCCHHHHHHHHHH | 32.54 | 27499020 | |
| 75 | Phosphorylation | SSPETLISDLLMRES CCHHHHHHHHHHHHC | 25.89 | 21964256 | |
| 82 | Phosphorylation | SDLLMRESTENVPRT HHHHHHHCCCCCCCC | 30.56 | 24076635 | |
| 83 | Phosphorylation | DLLMRESTENVPRTR HHHHHHCCCCCCCCC | 27.16 | 26657352 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NPY_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NPY_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NPY_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| NPY1R_HUMAN | NPY1R | physical | 7559383 | |
| NR1H2_HUMAN | NR1H2 | physical | 21988832 | |
| UBQL1_HUMAN | UBQLN1 | physical | 21988832 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
