| UniProt ID | NPY1R_HUMAN | |
|---|---|---|
| UniProt AC | P25929 | |
| Protein Name | Neuropeptide Y receptor type 1 | |
| Gene Name | NPY1R | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 384 | |
| Subcellular Localization |
Cell membrane Multi-pass membrane protein. |
|
| Protein Description | Receptor for neuropeptide Y and peptide YY. The rank order of affinity of this receptor for pancreatic polypeptides is NPY > [Pro-34] PYY, PYY and [Leu-31, Pro-34] NPY > NPY (2-36) > [Ile-31, Gln-34] PP and PYY (3-36) > PP > NPY free acid.. | |
| Protein Sequence | MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | N-linked_Glycosylation | ------MNSTLFSQV ------CCCCHHHHH | 43.64 | UniProtKB CARBOHYD | |
| 11 | N-linked_Glycosylation | TLFSQVENHSVHSNF CHHHHHCCCCCCCCC | 33.60 | UniProtKB CARBOHYD | |
| 17 | N-linked_Glycosylation | ENHSVHSNFSEKNAQ CCCCCCCCCCHHHCE | 29.59 | UniProtKB CARBOHYD | |
| 338 | S-palmitoylation | LQFFFNFCDFRSRDD HHHHHHHCCCCCCCC | 5.19 | - | |
| 347 | Phosphorylation | FRSRDDDYETIAMST CCCCCCCHHHHHHHH | 23.20 | 27642862 | |
| 349 | Phosphorylation | SRDDDYETIAMSTMH CCCCCHHHHHHHHCC | 14.06 | 29759185 | |
| 353 | Phosphorylation | DYETIAMSTMHTDVS CHHHHHHHHCCCCCC | 17.35 | 28857561 | |
| 354 | Phosphorylation | YETIAMSTMHTDVSK HHHHHHHHCCCCCCC | 10.41 | 27251275 | |
| 357 | Phosphorylation | IAMSTMHTDVSKTSL HHHHHCCCCCCCCCH | 27.55 | 27251275 | |
| 360 | Phosphorylation | STMHTDVSKTSLKQA HHCCCCCCCCCHHHC | 32.78 | 28857561 | |
| 362 | Phosphorylation | MHTDVSKTSLKQASP CCCCCCCCCHHHCCC | 31.61 | 28857561 | |
| 363 | Phosphorylation | HTDVSKTSLKQASPV CCCCCCCCHHHCCCC | 36.99 | 28857561 | |
| 368 | Phosphorylation | KTSLKQASPVAFKKI CCCHHHCCCCEEEEC | 19.88 | 25849741 | |
| 383 | Ubiquitination | NNNDDNEKI------ CCCCCCCCC------ | 61.03 | 33845483 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NPY1R_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NPY1R_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NPY1R_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of NPY1R_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach."; Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.; Anal. Chem. 81:4493-4501(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-368, AND MASSSPECTROMETRY. | |
