NKX22_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: NKX22_MOUSE
• UniProt AC: P42586
• Protein Name: Homeobox protein Nkx-2.2
• Gene Name: Nkx2-2
• Organism: Mus musculus (Mouse).
• Sequence Length: 273
• Subcellular Localization: Nucleus .
• Protein Description: Acts as a transcriptional activator. Required for the maintenance of NEUROD1 expression in the horomone-producing endocrine cells of the pancreas. May be involved in specifying diencephalic neuromeric boundaries, and in controlling the expression of genes that play a role in axonal guidance. Associates with chromatin at the NEUROD1 promoter region. Binds to a subset of consensus elements within the NEUROD1 promoter..
• Protein Sequence: MSLTNTKTGFSVKDILDLPDTNDEDGSVAEGPEEESEGPEPAKRAGPLGQGALDAVQSLPLKSPFYDSSDNPYTRWLASTEGLQYSLHGLAASAPPQDSSSKSPEPSADESPDNDKETQGGGGDAGKKRKRRVLFSKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKMKRARAEKGMEVTPLPSPRRVAVPVLVRDGKPCHALKAQDLAAATFQAGIPFSAYSAQSLQHMQYNAQYSSASTPQYPTAHPLVQAQQWTW

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
21	Phosphorylation	DILDLPDTNDEDGSV HHHCCCCCCCCCCCC	42.50	24759943
27	Phosphorylation	DTNDEDGSVAEGPEE CCCCCCCCCCCCCCH	30.40	24759943
63	Phosphorylation	VQSLPLKSPFYDSSD HHHCCCCCCCCCCCC	28.11	24759943
103	Phosphorylation	PQDSSSKSPEPSADE CCCCCCCCCCCCCCC	36.12	27841257
107	Phosphorylation	SSKSPEPSADESPDN CCCCCCCCCCCCCCC	46.84	27841257
195	Phosphorylation	AEKGMEVTPLPSPRR HHCCCCCCCCCCCCE	13.05	24759943
199	Phosphorylation	MEVTPLPSPRRVAVP CCCCCCCCCCEEEEE	38.43	24759943

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of NKX22_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of NKX22_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of NKX22_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TLX3_MOUSE	Tlx3	physical	20211142
OLIG2_MOUSE	Olig2	physical	14573534
GATA6_MOUSE	Gata6	physical	16887115

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.