NIPA3_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: NIPA3_ARATH
• UniProt AC: Q9LNK7
• Protein Name: Probable magnesium transporter NIPA3
• Gene Name: At1g34470
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 368
• Subcellular Localization: Cell membrane; Multi-pass membrane protein. Early endosome. Recruited to the cell membrane in response to low extracellular magnesium..
• Protein Description: Acts as a Mg(2+) transporter. Can also transport other divalent cations such as Fe(2+), Sr(2+), Ba(2+), Mn(2+) and Co(2+) but to a much less extent than Mg(2+) (By similarity)..
• Protein Sequence: MASLSGSWRDAYKGMSSDNIKGLVLALSSSLFIGASFIVKKKGLKRAGASGLRAGSGGYSYLLEPLWWVGMITMIVGEIANFAAYAFAPAILVTPLGALSIIISAALAHVILHEKLHTFGLLGCVLCVVGSITIVLHAPQEQEIDSVLQVWNLATEPAFLLYAAAVVGAAIILIVQFVPQYGQSHVMVYIGVCSLVGSLSVMSVKALGIALKLTFSGMNQLIYPQTWVFTLIVLTCVITQMNYLNKALDTFNTAVVSPIYYVMFTSLTILASVIMFKDWDRQDGTQIVTELCGFVTILSGTFLLHKTKDMVDGSSSLGNLALRLPKQLEDSNGFEQEGIPLTLRRHECTKSPRPMRQFILPQDGPEAV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
315	Phosphorylation	KDMVDGSSSLGNLAL CCCCCCCCHHHHHHH		22074104

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of NIPA3_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of NIPA3_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of NIPA3_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
HHP4_ARATH	HHP4	physical	24833385
HHP2_ARATH	HHP2	physical	24833385
UBC32_ARATH	UBC32	physical	24833385
UBC34_ARATH	UBC34	physical	24833385
NAC89_ARATH	NAC089	physical	24833385
FEI1_ARATH	FEI1	physical	24833385
CSK21_ARATH	CKA1	physical	24833385
CNIH1_ARATH	AT3G12180	physical	24833385
HSDD3_ARATH	AT2G43420	physical	24833385
CP21D_ARATH	AT3G66654	physical	24833385
RAA6A_ARATH	RABA6a	physical	24833385
RBL14_ARATH	RBL14	physical	24833385
LRK81_ARATH	AT3G53380	physical	24833385
VAP21_ARATH	AT5G47180	physical	24833385
BET12_ARATH	ATBET12	physical	24833385
Y1765_ARATH	AT1G07650	physical	24833385

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.