| UniProt ID | NFE4_HUMAN | |
|---|---|---|
| UniProt AC | Q86UQ8 | |
| Protein Name | Transcription factor NF-E4 | |
| Gene Name | NFE4 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 179 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Functions as part of the SSP (stage selector protein) complex, a complex that contributes to the preferential expression of the gamma-gene in fetal erythroid cells by facilitating the interaction of the gamma-globin genes with enhancer elements contained in the locus control region (LCR). The complex binds to the stage selector element (SSE) in the proximal gamma-globin promoter. In contrast, isoform 2 acts as a repressor of gamma-globin gene expression by preventing NFE2 and RNA polymerase II recruitment to the promoter.. | |
| Protein Sequence | MPRVVCWHTLKSLNGYKNLSSGAETREGLRSSSPVDLPLRPRKQATAAGQRKLLSLQLLLCACTSVTDLTYWGPAGHGATAPHRSLLAIHLHLVPASSAAMKATGPHNAQTQVNPQGHAPSAEDPTGTWTVSGPCKDHPHPFLSQSNPPTRISSALPLKTDSALEQTPQQLPSLHLSQG | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 43 | Acetylation | DLPLRPRKQATAAGQ CCCCCCCCCCCHHHH | 47.14 | 15273251 | |
| 43 | Ubiquitination | DLPLRPRKQATAAGQ CCCCCCCCCCCHHHH | 47.14 | 1527325 | |
| 126 | Phosphorylation | APSAEDPTGTWTVSG CCCCCCCCCCEEEEC | 60.61 | - | |
| 132 | Phosphorylation | PTGTWTVSGPCKDHP CCCCEEEECCCCCCC | 29.64 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NFE4_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NFE4_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| ANM5_HUMAN | PRMT5 | physical | 19234465 | |
| KAT2B_HUMAN | KAT2B | physical | 15273251 | |
| HDAC1_HUMAN | HDAC1 | physical | 15273251 | |
| TFCP2_HUMAN | TFCP2 | physical | 16263792 | |
| WDR5_HUMAN | WDR5 | physical | 22689669 | |
| ANM5_HUMAN | PRMT5 | physical | 22689669 | |
| NUCL_HUMAN | NCL | physical | 22689669 | |
| ICLN_HUMAN | CLNS1A | physical | 22689669 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Acetylation | |
| Reference | PubMed |
| "Site-specific acetylation of the fetal globin activator NF-E4prevents its ubiquitination and regulates its interaction with thehistone deacetylase, HDAC1."; Zhao Q., Cumming H., Cerruti L., Cunningham J.M., Jane S.M.; J. Biol. Chem. 279:41477-41486(2004). Cited for: INTERACTION WITH HDAC1 AND PCAF, UBIQUITINATION, ACETYLATION ATLYS-43, AND MUTAGENESIS OF LYS-43. | |