UniProt ID | NFE4_HUMAN | |
---|---|---|
UniProt AC | Q86UQ8 | |
Protein Name | Transcription factor NF-E4 | |
Gene Name | NFE4 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 179 | |
Subcellular Localization | Nucleus . | |
Protein Description | Functions as part of the SSP (stage selector protein) complex, a complex that contributes to the preferential expression of the gamma-gene in fetal erythroid cells by facilitating the interaction of the gamma-globin genes with enhancer elements contained in the locus control region (LCR). The complex binds to the stage selector element (SSE) in the proximal gamma-globin promoter. In contrast, isoform 2 acts as a repressor of gamma-globin gene expression by preventing NFE2 and RNA polymerase II recruitment to the promoter.. | |
Protein Sequence | MPRVVCWHTLKSLNGYKNLSSGAETREGLRSSSPVDLPLRPRKQATAAGQRKLLSLQLLLCACTSVTDLTYWGPAGHGATAPHRSLLAIHLHLVPASSAAMKATGPHNAQTQVNPQGHAPSAEDPTGTWTVSGPCKDHPHPFLSQSNPPTRISSALPLKTDSALEQTPQQLPSLHLSQG | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
43 | Acetylation | DLPLRPRKQATAAGQ CCCCCCCCCCCHHHH | 47.14 | 15273251 | |
43 | Ubiquitination | DLPLRPRKQATAAGQ CCCCCCCCCCCHHHH | 47.14 | 1527325 | |
126 | Phosphorylation | APSAEDPTGTWTVSG CCCCCCCCCCEEEEC | 60.61 | - | |
132 | Phosphorylation | PTGTWTVSGPCKDHP CCCCEEEECCCCCCC | 29.64 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NFE4_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NFE4_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
ANM5_HUMAN | PRMT5 | physical | 19234465 | |
KAT2B_HUMAN | KAT2B | physical | 15273251 | |
HDAC1_HUMAN | HDAC1 | physical | 15273251 | |
TFCP2_HUMAN | TFCP2 | physical | 16263792 | |
WDR5_HUMAN | WDR5 | physical | 22689669 | |
ANM5_HUMAN | PRMT5 | physical | 22689669 | |
NUCL_HUMAN | NCL | physical | 22689669 | |
ICLN_HUMAN | CLNS1A | physical | 22689669 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Acetylation | |
Reference | PubMed |
"Site-specific acetylation of the fetal globin activator NF-E4prevents its ubiquitination and regulates its interaction with thehistone deacetylase, HDAC1."; Zhao Q., Cumming H., Cerruti L., Cunningham J.M., Jane S.M.; J. Biol. Chem. 279:41477-41486(2004). Cited for: INTERACTION WITH HDAC1 AND PCAF, UBIQUITINATION, ACETYLATION ATLYS-43, AND MUTAGENESIS OF LYS-43. |