MYL1_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: MYL1_HUMAN
• UniProt AC: P05976
• Protein Name: Myosin light chain 1/3, skeletal muscle isoform
• Gene Name: MYL1
• Organism: Homo sapiens (Human).
• Sequence Length: 194
• Protein Description: Regulatory light chain of myosin. Does not bind calcium..
• Protein Sequence: MAPKKDVKKPVAAAAAAPAPAPAPAPAPAPAKPKEEKIDLSAIKIEFSKEQQDEFKEAFLLFDRTGDSKITLSQVGDVLRALGTNPTNAEVRKVLGNPSNEELNAKKIEFEQFLPMMQAISNNKDQATYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMKEEEVEALMAGQEDSNGCINYEAFVKHIMSI

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2 (in isoform 2)	Acetylation	-	25.31	-
2	Methylation	------MAPKKDVKK ------CCCHHHCCH	25.31	-
41	Phosphorylation	KEEKIDLSAIKIEFS CHHHCCHHEEECEEC	24.97	26437602
65	Phosphorylation	AFLLFDRTGDSKITL HHHHEECCCCCCEEH	47.38	19764811
68	Phosphorylation	LFDRTGDSKITLSQV HEECCCCCCEEHHHH	27.57	19764811
71	Phosphorylation	RTGDSKITLSQVGDV CCCCCCEEHHHHHHH	24.88	26437602
73	Phosphorylation	GDSKITLSQVGDVLR CCCCEEHHHHHHHHH	17.73	20068231
84	Phosphorylation	DVLRALGTNPTNAEV HHHHHHCCCCCCHHH	38.58	26437602
87	Phosphorylation	RALGTNPTNAEVRKV HHHCCCCCCHHHHHH	49.48	26437602
97	Ubiquitination	EVRKVLGNPSNEELN HHHHHHCCCCHHHHH	32.44	21890473
97	Ubiquitination	EVRKVLGNPSNEELN HHHHHHCCCCHHHHH	32.44	21890473
99	Phosphorylation	RKVLGNPSNEELNAK HHHHCCCCHHHHHHC	61.96	19764811
121	Phosphorylation	LPMMQAISNNKDQAT HHHHHHHHCCCCCCC	37.05	20068231
141	Ubiquitination	EGLRVFDKEGNGTVM HHEEEEEECCCCEEE	56.93	23000965
141	Acetylation	EGLRVFDKEGNGTVM HHEEEEEECCCCEEE	56.93	21466224
146	Phosphorylation	FDKEGNGTVMGAELR EEECCCCEEEHHHHH	16.00	26437602
158	Phosphorylation	ELRHVLATLGEKMKE HHHHHHHHHHHHHCH	31.00	26437602
162	Acetylation	VLATLGEKMKEEEVE HHHHHHHHHCHHHHH	54.17	19847527
178	Phosphorylation	LMAGQEDSNGCINYE HHCCCCCCCCCCCHH	34.08	19764811
181	S-nitrosylation	GQEDSNGCINYEAFV CCCCCCCCCCHHHHH	1.82	22178444
181	S-nitrosocysteine	GQEDSNGCINYEAFV CCCCCCCCCCHHHHH	1.82	-
184	Phosphorylation	DSNGCINYEAFVKHI CCCCCCCHHHHHHHH	6.68	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
-	K	Ubiquitination	E3 ubiquitin ligase	TRIM63	Q969Q1	PMID:22199232

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of MYL1_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of MYL1_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
A4_HUMAN	APP	physical	21832049
SEPT2_HUMAN	SEPT2	physical	22939629
NU107_HUMAN	NUP107	physical	22939629
SAE2_HUMAN	UBA2	physical	22939629
IQGA1_HUMAN	IQGAP1	physical	18587628

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.