MUD1_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: MUD1_SCHPO
• UniProt AC: Q10256
• Protein Name: UBA domain-containing protein mud1
• Gene Name: mud1
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 332
• Protein Sequence: MNNLTPENIRQTILATPFLLNRIRTEFPQLAAVLNDPNAFATTWQSINASQLLQIPSSTYSMGMPSFSEDDLFDVEVQRRIEEQIRQNAVTENMQSAIENHPEVFGQVYMLFVNVEINGHKVKAFVDSGAQATILSADCAEKCGLTRLLDTRFQGVAKGVGMAKILGCVHSAPLKIGDLYLPCRFTVIEGRDVDMLLGLDMLRRYQACIDLENNVLRIHGKEIPFLGESEIPKLLANVEPSANAHGLGIEPASKASASSPNPQSGTRLGTKESVAPNNEGSSNPPSLVNPPTDPGLNSKIAQLVSMGFDPLEAAQALDAANGDLDVAASFLL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
258	Phosphorylation	PASKASASSPNPQSG CCCCCCCCCCCCCCC	43.78	29996109
259	Phosphorylation	ASKASASSPNPQSGT CCCCCCCCCCCCCCC	28.54	24763107
270	Phosphorylation	QSGTRLGTKESVAPN CCCCCCCCCCCCCCC	35.91	21712547

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of MUD1_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of MUD1_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of MUD1_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
YFE6_SCHPO	gmh5	genetic	18818364
B2L11_RAT	Bcl2l11	physical	21378313
IMG2_SCHPO	img2	genetic	22681890
SNF5_SCHPO	snf5	genetic	22681890
YAS9_SCHPO	nab3	genetic	22681890
MED1_SCHPO	pmc2	genetic	22681890
MKH1_SCHPO	mkh1	genetic	22681890
SLX9_SCHPO	slx9	genetic	22681890
UBI4P_SCHPO	ubi4	physical	22095407

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.