UniProt ID | B2L11_RAT | |
---|---|---|
UniProt AC | O88498 | |
Protein Name | Bcl-2-like protein 11 | |
Gene Name | Bcl2l11 | |
Organism | Rattus norvegicus (Rat). | |
Sequence Length | 196 | |
Subcellular Localization |
Membrane Peripheral membrane protein. Mitochondrion. Associated with intracytoplasmic membranes.. |
|
Protein Description | Induces apoptosis and anoikis.. | |
Protein Sequence | MAKQPSDVNSECDREGGQLQPAERPPQLRPGAPTSLQTESQGNPDGEGDRCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASIRQSQEEPEDLRPEIRIAQELRRIGDEFNETYTRRAFANDYREAEDHPQMVILQLLRFIFRLVWRRH | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
3 | Ubiquitination | -----MAKQPSDVNS -----CCCCCCCCCC | 62.53 | - | |
55 | Phosphorylation | GDRCPHGSPQGPLAP CCCCCCCCCCCCCCC | 15.83 | 28432305 | |
65 | Phosphorylation | GPLAPPASPGPFATR CCCCCCCCCCCCCCC | 35.84 | 28432305 | |
73 | Phosphorylation | PGPFATRSPLFIFVR CCCCCCCCCEEEEEE | 22.92 | 28432305 | |
82 | Phosphorylation | LFIFVRRSSLLSRSS EEEEEECHHHHCCCC | 18.12 | 28432305 | |
83 | Phosphorylation | FIFVRRSSLLSRSSS EEEEECHHHHCCCCC | 31.36 | 28432305 | |
88 | Phosphorylation | RSSLLSRSSSGYFSF CHHHHCCCCCCCEEE | 26.02 | 25575281 | |
89 | Phosphorylation | SSLLSRSSSGYFSFD HHHHCCCCCCCEEEC | 27.03 | 28432305 | |
90 | Phosphorylation | SLLSRSSSGYFSFDT HHHCCCCCCCEEECC | 38.47 | 28432305 | |
92 | Phosphorylation | LSRSSSGYFSFDTDR HCCCCCCCEEECCCC | 9.67 | 25575281 | |
94 | Phosphorylation | RSSSGYFSFDTDRSP CCCCCCEEECCCCCC | 17.46 | 28432305 | |
97 | Phosphorylation | SGYFSFDTDRSPAPM CCCEEECCCCCCCCC | 31.16 | 28432305 | |
100 | Phosphorylation | FSFDTDRSPAPMSCD EEECCCCCCCCCCCC | 28.37 | 28689409 | |
108 | Ubiquitination | PAPMSCDKSTQTPSP CCCCCCCCCCCCCCC | 60.78 | - | |
109 | Phosphorylation | APMSCDKSTQTPSPP CCCCCCCCCCCCCCC | 16.70 | 12388545 | |
110 | Phosphorylation | PMSCDKSTQTPSPPC CCCCCCCCCCCCCCH | 42.05 | 12388545 | |
112 | Phosphorylation | SCDKSTQTPSPPCQA CCCCCCCCCCCCHHH | 26.31 | 15470142 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
55 | S | Phosphorylation | Kinase | MAPK8 | P45983 | GPS |
65 | S | Phosphorylation | Kinase | MAPK1 | P28482 | GPS |
65 | S | Phosphorylation | Kinase | MAPK3 | P27361 | GPS |
65 | S | Phosphorylation | Kinase | MAPK8 | P45983 | GPS |
65 | S | Phosphorylation | Kinase | P38A | Q16539 | PSP |
65 | S | Phosphorylation | Kinase | MAPK14 | P70618 | GPS |
65 | S | Phosphorylation | Kinase | MAPK | - | Uniprot |
Modified Location | Modified Residue | Modification | Function | Reference |
---|---|---|---|---|
65 | S | Phosphorylation |
| - |
65 | S | ubiquitylation |
| - |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of B2L11_RAT !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...