B2L11_RAT - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: B2L11_RAT
• UniProt AC: O88498
• Protein Name: Bcl-2-like protein 11
• Gene Name: Bcl2l11
• Organism: Rattus norvegicus (Rat).
• Sequence Length: 196
• Subcellular Localization: Membrane; Peripheral membrane protein. Mitochondrion. Associated with intracytoplasmic membranes..
• Protein Description: Induces apoptosis and anoikis..
• Protein Sequence: MAKQPSDVNSECDREGGQLQPAERPPQLRPGAPTSLQTESQGNPDGEGDRCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASIRQSQEEPEDLRPEIRIAQELRRIGDEFNETYTRRAFANDYREAEDHPQMVILQLLRFIFRLVWRRH

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
3	Ubiquitination	-----MAKQPSDVNS -----CCCCCCCCCC	62.53	-
55	Phosphorylation	GDRCPHGSPQGPLAP CCCCCCCCCCCCCCC	15.83	28432305
65	Phosphorylation	GPLAPPASPGPFATR CCCCCCCCCCCCCCC	35.84	28432305
73	Phosphorylation	PGPFATRSPLFIFVR CCCCCCCCCEEEEEE	22.92	28432305
82	Phosphorylation	LFIFVRRSSLLSRSS EEEEEECHHHHCCCC	18.12	28432305
83	Phosphorylation	FIFVRRSSLLSRSSS EEEEECHHHHCCCCC	31.36	28432305
88	Phosphorylation	RSSLLSRSSSGYFSF CHHHHCCCCCCCEEE	26.02	25575281
89	Phosphorylation	SSLLSRSSSGYFSFD HHHHCCCCCCCEEEC	27.03	28432305
90	Phosphorylation	SLLSRSSSGYFSFDT HHHCCCCCCCEEECC	38.47	28432305
92	Phosphorylation	LSRSSSGYFSFDTDR HCCCCCCCEEECCCC	9.67	25575281
94	Phosphorylation	RSSSGYFSFDTDRSP CCCCCCEEECCCCCC	17.46	28432305
97	Phosphorylation	SGYFSFDTDRSPAPM CCCEEECCCCCCCCC	31.16	28432305
100	Phosphorylation	FSFDTDRSPAPMSCD EEECCCCCCCCCCCC	28.37	28689409
108	Ubiquitination	PAPMSCDKSTQTPSP CCCCCCCCCCCCCCC	60.78	-
109	Phosphorylation	APMSCDKSTQTPSPP CCCCCCCCCCCCCCC	16.70	12388545
110	Phosphorylation	PMSCDKSTQTPSPPC CCCCCCCCCCCCCCH	42.05	12388545
112	Phosphorylation	SCDKSTQTPSPPCQA CCCCCCCCCCCCHHH	26.31	15470142

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
55	S	Phosphorylation	Kinase	MAPK8	P45983	GPS
65	S	Phosphorylation	Kinase	MAPK1	P28482	GPS
65	S	Phosphorylation	Kinase	MAPK3	P27361	GPS
65	S	Phosphorylation	Kinase	MAPK8	P45983	GPS
65	S	Phosphorylation	Kinase	P38A	Q16539	PSP
65	S	Phosphorylation	Kinase	MAPK14	P70618	GPS
65	S	Phosphorylation	Kinase	MAPK	-	Uniprot

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
65	S	Phosphorylation	Phosphorylation at Ser-65 by MAPK1/MAPK3 leads interaction with TRIM2 and ubiquitination, followed by proteasomal degradation.	-
65	S	ubiquitylation	Phosphorylation at Ser-65 by MAPK1/MAPK3 leads interaction with TRIM2 and ubiquitination, followed by proteasomal degradation.	-

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of B2L11_RAT !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
UBC_RAT	Ubc	physical	21478148

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.