| UniProt ID | MT21D_HUMAN | |
|---|---|---|
| UniProt AC | Q9H867 | |
| Protein Name | Protein-lysine methyltransferase METTL21D | |
| Gene Name | VCPKMT | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 229 | |
| Subcellular Localization | Cytoplasm . | |
| Protein Description | Protein-lysine N-methyltransferase that specifically trimethylates 'Lys-315' of VCP/p97; this modification may decrease VCP ATPase activity.. | |
| Protein Sequence | MADTLESSLEDPLRSFVRVLEKRDGTVLRLQQYSSGGVGCVVWDAAIVLSKYLETPEFSGDGAHALSRRSVLELGSGTGAVGLMAATLGADVVVTDLEELQDLLKMNINMNKHLVTGSVQAKVLKWGEEIEGFPSPPDFILMADCIYYEESLEPLLKTLKDISGFETCIICCYEQRTMGKNPEIEKKYFELLQLDFDFEKIPLEKHDEEYRSEDIHIIYIRKKKSKFPS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MADTLESSL ------CCCCHHHHC | 20.63 | 22814378 | |
| 7 | Phosphorylation | -MADTLESSLEDPLR -CCCCHHHHCCCHHH | 43.25 | 23186163 | |
| 8 | Phosphorylation | MADTLESSLEDPLRS CCCCHHHHCCCHHHH | 26.80 | 14702039 | |
| 112 | Ubiquitination | KMNINMNKHLVTGSV HCCCCCCCCCCCCCH | 27.78 | 29967540 | |
| 112 (in isoform 1) | Ubiquitination | - | 27.78 | - | |
| 122 | Ubiquitination | VTGSVQAKVLKWGEE CCCCHHHEEECCCHH | 30.89 | 29967540 | |
| 122 (in isoform 1) | Ubiquitination | - | 30.89 | - | |
| 188 | Phosphorylation | NPEIEKKYFELLQLD CHHHHHHHHHHHHCC | 17.22 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MT21D_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MT21D_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MT21D_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| ALDOA_HUMAN | ALDOA | physical | 23349634 | |
| ASPC1_HUMAN | ASPSCR1 | physical | 23349634 | |
| HEXB_HUMAN | HEXB | physical | 23349634 | |
| GRP75_HUMAN | HSPA9 | physical | 23349634 | |
| LAGE3_HUMAN | LAGE3 | physical | 23349634 | |
| METK2_HUMAN | MAT2A | physical | 23349634 | |
| TBB2A_HUMAN | TUBB2A | physical | 23349634 | |
| TBB3_HUMAN | TUBB3 | physical | 23349634 | |
| UBB_HUMAN | UBB | physical | 23349634 | |
| UBC_HUMAN | UBC | physical | 23349634 | |
| UBXN6_HUMAN | UBXN6 | physical | 23349634 | |
| TERA_HUMAN | VCP | physical | 23349634 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
