UniProt ID | MSS51_SCHPO | |
---|---|---|
UniProt AC | Q9UTB4 | |
Protein Name | Protein mss51 | |
Gene Name | mss51 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 378 | |
Subcellular Localization |
Mitochondrion inner membrane Peripheral membrane protein Matrix side. |
|
Protein Description | Has a dual role in the assembly of cytochrome oxidase subunit 1 (cox1). It has a regulative function on cox1 synthesis, acting as a translational activator specific for the cox1 mRNA, and it also binds to newly synthesized cox1 protein (By similarity).. | |
Protein Sequence | MSFLKNLFKKKSPTHELFHPLSRSPLTALRRRSEHIKQVYRCPISGKSVEYECPESGFPTHCNRTHWEQDKIHQSLIPKLRQINEDYHDLARPNPLPELLKLPGPMEEDEVVSLLSWDSFFYTRDFPKFQSSRTARHITSLLTYPMSIGAILHKNSPYNLKNGLTPQGLQSLTALRYMLHRPLSAQSTDPRPTRIFVLGATKECSLPPSIWLQGLNFLFPGRLFQLHFIGPEVVVPSKQPNLPSPLSLHFHQDYYHNLHRVGAFEPFDPYYDTFFLPMPLISHPLYSSSWIPTLHDLVSTRCSVWLTSPSSQRTTKDLEVLNNVLKDSIEPLLLPTVNKFASLGWSVDDSNLHEVYHANQEVFGFRALYYNVQNVSKE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of MSS51_SCHPO !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MSS51_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MSS51_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MSS51_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
YAWC_SCHPO | SPAC3F10.12c | physical | 26771498 | |
TVP15_SCHPO | SPAC6F12.04 | physical | 26771498 | |
ATG11_SCHPO | atg11 | physical | 26771498 | |
MOC3_SCHPO | moc3 | physical | 26771498 | |
DMC1_SCHPO | dmc1 | physical | 26771498 | |
CBH1_SCHPO | cbh1 | physical | 26771498 | |
YH7G_SCHPO | SPBC16G5.16 | physical | 26771498 | |
YBH8_SCHPO | SPBC3B8.08 | physical | 26771498 | |
PIL1_SCHPO | pil1 | physical | 26771498 | |
YOP1_SCHPO | yop1 | physical | 26771498 | |
HSP7M_SCHPO | ssc1 | physical | 27257059 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...