UniProt ID | MSRB3_HUMAN | |
---|---|---|
UniProt AC | Q8IXL7 | |
Protein Name | Methionine-R-sulfoxide reductase B3 | |
Gene Name | MSRB3 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 192 | |
Subcellular Localization |
Isoform 1: Endoplasmic reticulum. Isoform 2: Mitochondrion. |
|
Protein Description | Catalyzes the reduction of free and protein-bound methionine sulfoxide to methionine. Isoform 2 is essential for hearing.. | |
Protein Sequence | MSPRRTLPRPLSLCLSLCLCLCLAAALGSAQSGSCRDKKNCKVVFSQQELRKRLTPLQYHVTQEKGTESAFEGEYTHHKDPGIYKCVVCGTPLFKSETKFDSGSGWPSFHDVINSEAITFTDDFSYGMHRVETSCSQCGAHLGHIFDDGPRPTGKRYCINSAALSFTPADSSGTAEGGSGVASPAQADKAEL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MSPRRTLPR ------CCCCCCCCH | 27.41 | 24719451 | |
2 (in isoform 2) | Phosphorylation | - | 27.41 | 22199227 | |
11 (in isoform 2) | Phosphorylation | - | 6.88 | 20068231 | |
25 (in isoform 2) | Phosphorylation | - | 7.11 | 28348404 | |
27 | Phosphorylation | CLCLAAALGSAQSGS HHHHHHHHHHCCCCC | 4.83 | 27251275 | |
27 (in isoform 2) | Phosphorylation | - | 4.83 | 28348404 | |
42 | Acetylation | CRDKKNCKVVFSQQE CCCCCCCEEEECHHH | 51.32 | - | |
59 | Phosphorylation | KRLTPLQYHVTQEKG HHCCCCEEEEECCCC | 13.12 | 18083107 | |
183 | Phosphorylation | EGGSGVASPAQADKA CCCCCCCCHHHHHHH | 20.54 | 22199227 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MSRB3_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MSRB3_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MSRB3_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
KLHL7_HUMAN | KLHL7 | physical | 28514442 | |
RET4_HUMAN | RBP4 | physical | 28514442 | |
SPOP_HUMAN | SPOP | physical | 28514442 | |
C1QRF_HUMAN | C1QL1 | physical | 28514442 | |
BTBD9_HUMAN | BTBD9 | physical | 28514442 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
613718 | Deafness, autosomal recessive, 74 (DFNB74) | |||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...