| UniProt ID | MORN3_HUMAN | |
|---|---|---|
| UniProt AC | Q6PF18 | |
| Protein Name | MORN repeat-containing protein 3 | |
| Gene Name | MORN3 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 240 | |
| Subcellular Localization | ||
| Protein Description | ||
| Protein Sequence | MPVSKCPKKSESLWKGWDRKAQRNGLRSQVYAVNGDYYVGEWKDNVKHGKGTQVWKKKGAIYEGDWKFGKRDGYGTLSLPDQQTGKCRRVYSGWWKGDKKSGYGIQFFGPKEYYEGDWCGSQRSGWGRMYYSNGDIYEGQWENDKPNGEGMLRLKNGNRYEGCWERGMKNGAGRFFHLDHGQLFEGFWVDNMAKCGTMIDFGRDEAPEPTQFPIPEVKILDPDGVLAEALAMFRKTEEGD | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 10 | Phosphorylation | VSKCPKKSESLWKGW CCCCCCCCCCHHCCC | 38.25 | 30622161 | |
| 12 | Phosphorylation | KCPKKSESLWKGWDR CCCCCCCCHHCCCCH | 46.77 | 30622161 | |
| 76 | Phosphorylation | GKRDGYGTLSLPDQQ CCCCCCCCCCCCCCC | 12.51 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MORN3_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MORN3_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MORN3_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| MAGA6_HUMAN | MAGEA6 | physical | 21516116 | |
| LOXE3_HUMAN | ALOXE3 | physical | 28514442 | |
| RNAS7_HUMAN | RNASE7 | physical | 28514442 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...