UniProt ID | MORN3_HUMAN | |
---|---|---|
UniProt AC | Q6PF18 | |
Protein Name | MORN repeat-containing protein 3 | |
Gene Name | MORN3 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 240 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MPVSKCPKKSESLWKGWDRKAQRNGLRSQVYAVNGDYYVGEWKDNVKHGKGTQVWKKKGAIYEGDWKFGKRDGYGTLSLPDQQTGKCRRVYSGWWKGDKKSGYGIQFFGPKEYYEGDWCGSQRSGWGRMYYSNGDIYEGQWENDKPNGEGMLRLKNGNRYEGCWERGMKNGAGRFFHLDHGQLFEGFWVDNMAKCGTMIDFGRDEAPEPTQFPIPEVKILDPDGVLAEALAMFRKTEEGD | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
10 | Phosphorylation | VSKCPKKSESLWKGW CCCCCCCCCCHHCCC | 38.25 | 30622161 | |
12 | Phosphorylation | KCPKKSESLWKGWDR CCCCCCCCHHCCCCH | 46.77 | 30622161 | |
76 | Phosphorylation | GKRDGYGTLSLPDQQ CCCCCCCCCCCCCCC | 12.51 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MORN3_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MORN3_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MORN3_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
MAGA6_HUMAN | MAGEA6 | physical | 21516116 | |
LOXE3_HUMAN | ALOXE3 | physical | 28514442 | |
RNAS7_HUMAN | RNASE7 | physical | 28514442 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...